PACRG Antibody - BSA Free

Immunohistochemistry-Paraffin: PACRG Antibody [NBP2-55838] - Staining of human placenta shows low expression as expected.

Immunohistochemistry-Paraffin: PACRG Antibody [NBP2-55838] - Staining of human fallopian tube shows high expression.

Immunohistochemistry-Paraffin: PACRG Antibody [NBP2-55838] - Staining in human fallopian tube and placenta tissues using anti-PACRG antibody. Corresponding PACRG RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PACRG Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PACRG Antibody - BSA Free (NBP2-55838) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AFKERPTKPTAFRKFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLF
• Predicted Species: Mouse (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PACRG
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PACRG Recombinant Protein Antigen (NBP2-55838PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PACRG Antibody - BSA Free

• FLJ32724
• Glup
• HAK005771
• Molecular chaperone/chaperonin-binding protein
• PARK2 coregulated gene protein
• PARK2 co-regulated
• PARK2CRG
• parkin coregulated gene protein
• parkin co-regulated gene protein
• RP3-495O10.2

Background

PACRG (also known as Parkin coregulated gene protein and PARK2 coregulated) is a gene located very close to parkin, in reverse orientation on the chromosome. It is thought to be co-transcribed with parkin by a bi-directional promoter between the two genes. PACRG is expressed in all immune tissues, spleen, lymph nodes, thymus, tonsils, leukocyte and bone marrow and is also expressed in heart, brain, skeletal muscle, kidney, lung and pancreas. PACRG is expressed in primary Schwann cells and very weakly by monocyte-derived macrophages, which are the primary host cells of Mycobacterium leprae, the causative agent of leprosy. Splice variants have been described for this protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PACRG