Novus Biologicals products are now on bio-techne.com

5T4 Antibody (1B6)

Images

 
Western Blot: 5T4 Antibody (1B6) [H00007162-M09] - Analysis of TPBG expression in HeLa (Cat # L013V1).
Western Blot: 5T4 Antibody (1B6) [H00007162-M09] - Analysis of TPBG expression in PC-12 (Cat # L012V1).
Sandwich ELISA: 5T4 Antibody (1B6) [H00007162-M09] - Detection limit for recombinant GST tagged TPBG is approximately 1ng/ml as a capture antibody.
Sandwich ELISA: 5T4 Antibody (1B6) [H00007162-M09] - Detection limit for recombinant GST tagged TPBG is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA
Clone
1B6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

5T4 Antibody (1B6) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
TPBG (NP_006661, 219 a.a. ~ 328 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SNHFLYLPRDVLAQLPSLRHLDLSNNSLVSLTYVSFRNLTHLESLHLEDNALKVLHNGTLAELQGLPHIRVFLDNNPWVCDCHMADMVTWLKETEVVQGKDRLTCAYPEK
Specificity
TPBG - trophoblast glycoprotein, (1B6)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TPBG
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot
Application Notes
Antibody reactivity against cell lysate for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for 5T4 Antibody (1B6)

  • 5T4 oncofetal trophoblast glycoprotein
  • 5T4 oncotrophoblast glycoprotein
  • 5T4
  • 5T4AG
  • 5T4-AG
  • 5T4M6P1,5T4 oncofetal antigen
  • M6P1
  • TPBG
  • trophoblast glycoprotein

Background

The 5T4 gene encodes a leucine-rich transmembrane glycoprotein that may be involved in cell adhesion. The encoded protein is an oncofetal antigen that is specific to trophoblast cells. In adults this protein is highly expressed in many tumor cells and is ass

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DLP00
Species: Hu
Applications: ELISA
MAB1790
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-03886
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-48309
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
AF972
Species: Hu
Applications: ELISA, IHC, KO, Simple Western, WB
NBP3-25538
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
MAB6896
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
H00135138-D01P
Species: Hu, Mu
Applications: WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
AF5070
Species: Hu
Applications: Simple Western, WB
268-N4/CF
Species: Hu
Applications: BA
NBP3-14348
Species: Hu
Applications: IHC, IHC-P
NBP2-48480
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
AF1053
Species: Mu
Applications: IHC, WB
NB500-517
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-85645
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00007162-M09
Species: Hu, Rt
Applications: WB, ELISA

Publications for 5T4 Antibody (H00007162-M09) (0)

There are no publications for 5T4 Antibody (H00007162-M09).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 5T4 Antibody (H00007162-M09) (0)

There are no reviews for 5T4 Antibody (H00007162-M09). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 5T4 Antibody (H00007162-M09) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional 5T4 Products

Research Areas for 5T4 Antibody (H00007162-M09)

Find related products by research area.

Blogs on 5T4

There are no specific blogs for 5T4, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 5T4 Antibody (1B6) and receive a gift card or discount.

Bioinformatics

Gene Symbol TPBG
Entrez
Uniprot