| Reactivity | Hu, Po, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit 5'-Nucleotidase/CD73 Antibody - BSA Free (NBP1-85740) is a polyclonal antibody validated for use in IHC, WB, ELISA, Flow and ICC/IF. Anti-5'-Nucleotidase/CD73 Antibody: Cited in 12 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQK |
| Predicted Species | Mouse (90%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NT5E |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Ewa Kaniewska |
WB | Human | 05/13/2014 |
Summary
|
||||||
Enlarge |
reviewed by:
Ewa Kaniewska |
IF | Human | 04/13/2014 |
Summary
|
||||||
Enlarge |
reviewed by:
Ewa Kaniewska |
ICC | Other | 03/27/2014 |
Summary
|
||||||
Enlarge |
reviewed by:
Ewa Kaniewska |
IHC-P | Human | 03/27/2014 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for 5'-Nucleotidase/CD73 Antibody (NBP1-85740)Find related products by research area.
|
|
Adenosine Inhibits T cell Tumor Infiltration: KCa3.1, a New Anticancer Target By Yoskaly Lazo-Fernandez, PhD Role of Adenosine in the Tumor Microenvironment a Target for Cancer TherapyThe tumor microenvironment (TME) tends to be concentrated in the purine nucleoside adenosine, a direct resu... Read full blog post. |
|
CD73 (Cluster of differentiation 73, ecto-5'-nucleotidase) CD73 is a 70kD glycosyl-phosphatidylinositol (GPI)-anchored cell surface molecule that belongs to the 5'-nucleosidase family. It hydrolyzes extracellular nucleotides into membrane permeable nucleosides and is found as both a membrane-bound and soluble... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Ewa Kaniewska 05/13/2014 |
||
| Application: | WB | |
| Species: | Human |
| Ewa Kaniewska 04/13/2014 |
||
| Application: | IF | |
| Species: | Human |
| Ewa Kaniewska 03/27/2014 |
||
| Application: | ICC | |
| Species: | Other |