Recombinant Human ZP2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZP2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 400-509 of Human ZP2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NSSCQPVFEAQSQGLVRFHIPLNGCGTRYKFEDDKVVYENEIHALWTDFPPSKISRDSEFRMTVKCSYSRNDMLLNINVESLTPPVASVKLGPFTLILQSYPDNSYQQPY

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ZP2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZP2 Protein

  • zona pellucida glycoprotein 2 (sperm receptor)
  • Zona pellucida glycoprotein 2
  • zona pellucida glycoprotein ZP2
  • Zona Pellucida Protein A
  • zona pellucida sperm-binding protein 2
  • ZP2
  • Zp-2
  • ZPA

Background

The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. The protein encoded by this gene is a structural component of the zona pellucida and functions in secondary binding and penetration of acrosome-reacted spermatozoa. The nascent protein contains a N-terminal signal peptide sequence, a conserved ZP domain, a consensus furin cleavage site, and a C-terminal transmembrane domain. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix. However, the requirement for furin cleavage in this process remains controversial based on mouse studies. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30830
Species: Hu
Applications: IHC, IHC-P
NBP1-86823
Species: Hu
Applications: IHC, IHC-P
423-F8/CF
Species: Hu, Mu
355-BM/CF
Species: Hu, Mu, Rt
NBP2-14260
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
H00344018-P01
Species: Hu
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP
AF3876
Species: Hu, Mu
Applications: WB, IHC
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-52149
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
3008-WN/CF
Species: Hu
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
H00007783-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for ZP2 Partial Recombinant Protein (H00007783-Q01) (0)

There are no publications for ZP2 Partial Recombinant Protein (H00007783-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZP2 Partial Recombinant Protein (H00007783-Q01) (0)

There are no reviews for ZP2 Partial Recombinant Protein (H00007783-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZP2 Partial Recombinant Protein (H00007783-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZP2 Products

Bioinformatics Tool for ZP2 Partial Recombinant Protein (H00007783-Q01)

Discover related pathways, diseases and genes to ZP2 Partial Recombinant Protein (H00007783-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZP2 Partial Recombinant Protein (H00007783-Q01)

Discover more about diseases related to ZP2 Partial Recombinant Protein (H00007783-Q01).
 

Pathways for ZP2 Partial Recombinant Protein (H00007783-Q01)

View related products by pathway.

PTMs for ZP2 Partial Recombinant Protein (H00007783-Q01)

Learn more about PTMs related to ZP2 Partial Recombinant Protein (H00007783-Q01).

Blogs on ZP2

There are no specific blogs for ZP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ZP2 Antibody
NBP1-86103

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZP2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZP2
Entrez