Home » ZNF654 » ZNF654 Antibodies » ZNF654 Antibody

ZNF654 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: ZNF654 Antibody [NBP3-10966] - Western blot analysis of ZNF654 in 721_B cell lysate. Antibody dilution at 0.2-1 ug/ml
Western Blot: ZNF654 Antibody [NBP3-10966] - Western blot analysis of ZNF654 in 721_B cell lysate. Antibody dilution at 0.2-1 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ZNF654 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF654 (NP_060763). Peptide sequence GRKFRNRGLMQKHLKNHVKKIQRQQIAAAQQDDQEVTALEEINCSSSSIS
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF654
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
66 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for ZNF654 Antibody

  • FLJ10997
  • FLJ21142
  • zinc finger protein 654

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PMEL17/SILV
Antibody (OTI10E5)
NBP1-47974
Western Blot: PMEL17/SILV Antibody (10E5) [NBP1-47974] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PMEL17/SILV(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PMEL17/SILV.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-PMEL17/SILV mouse monoclonal antibody.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded breast tissue using anti-PMEL17/SILV mouse monoclonal antibody.
(1 Review)
Species: Ca, Hu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Melan-A/MART-1
Antibody (A19-P)
NBP1-30151
Immunohistochemistry-Paraffin: Melan-A/MART-1 Antibody (A19-P) [NBP1-30151] - Human tissue (4 um section) stained with anti - Melan A monospecific clonal antibody.
Immunohistochemistry-Paraffin: Melan-A/MART-1 Antibody (A19-P) [NBP1-30151] - Confocal microscopy image of human fetal inner ear tisue section stained with Melan-A antibody (green), 1:200 dilution, incubated over night. IHC-P image submitted by a verified customer review.
(4 Reviews)
(15 Publications)
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NG2/MCSP Antibody
(LHM 2)
NB100-2688
Flow Cytometry: NG2/MCSP Antibody (LHM 2) [NB100-2688] - A cell surface stain was performed on SK-MEL-28 cells with NG2/MCSP antibody (LHM 2) NB100-2688AF700 (blue) and a matched isotype control (orange). Cells were incubated in an antibody dilution of 5 ug/mL for 20 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 700.
Knockout Validated: NG2/MCSP Antibody (LHM 2) [NB100-2688] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and NG2/MCSP (LHM2) knockout (KO) HeLa cell line. PVDF membrane was probed with 1.0 ug/ml of Mouse Anti-Human NG2/MCSP (LHM2) Polyclonal Antibody (Catalog # NB100-2688) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for NG2/MCSP (LHM2) at approximately 300 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Flow Cytometry: NG2/MCSP Antibody (LHM 2) [NB100-2688] - Antibody was tested at 1:400 in MCF7 cells using an Alexa Fluor 488 secondary (shown in green) alongside unstained cells (shown in red).
(7 Publications)
Species: Hu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
Tyrosinase
Antibody (JA52-11)
NBP2-67232
Immunocytochemistry/Immunofluorescence: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Staining Tyrosinase in A431 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Staining Tyrosinase in MCF-7 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Analysis of paraffin-embedded human liver tissue using anti-Tyrosinase antibody. Counter stained with hematoxylin.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
IL-2 [Unconjugated]
202-IL
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
(26 Reviews)
(338 Publications)
Species: Hu
Applications: BA
IFN-gamma
[Unconjugated]
285-IF
Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The activity is over 2-fold greater than the top competitor's IFN-gamma .
1 μg/lane of Recombinant Human IFN-gamma was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
(24 Reviews)
(389 Publications)
Species: Hu
Applications: BA
CD8 Antibody
(53-6.7) - BSA Free
NBP1-49045
Immunohistochemistry-Paraffin: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - CD8 alpha expression in mouse spleen tissue using anti-CD8 alpha antibody. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of bone marrow tissue by single and multiple staining.
Immunohistochemistry-Frozen: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of mosue spleen sections. CD8+ lymphocytes are marked by brown labeling of the cell surface.
(3 Reviews)
(19 Publications)
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
SI
Sucrase-Isomaltase An
NBP1-87581
Immunohistochemistry-Paraffin: SI Sucrase-Isomaltase Antibody [NBP1-87581] - Analysis in human small intestine and stomach tissues. Corresponding SI RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SI Sucrase-Isomaltase Antibody [NBP1-87581] - Staining of human small intestine shows moderate to strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: SI Sucrase-Isomaltase Antibody [NBP1-87581] - Staining of human duodenum shows moderate to strong membranous positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Reviews)
(2 Publications)
Species: Hu
Applications: BA
Doublecortin
Antibody
NBP1-72042
Western Blot: Doublecortin Antibody [NBP1-72042] - staining of Mouse fetal Brain lysate (35 ug protein in RIPA buffer). Antibody at 0.01 ug/mL. Primary incubation was 1 hour. Detected by chemiluminescence.
Immunocytochemistry/Immunofluorescence: Doublecortin Antibody [NBP1-72042] - Immunofluorescence analysis of paraformaldehyde fixed HepG2 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (5 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL), showing cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL).
Immunocytochemistry/Immunofluorescence: Doublecortin Antibody [NBP1-72042] - Immunofluorescence analysis of paraformaldehyde fixed KNRK cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
HLA ABC Antibody
(W6/32) - Azide and B ...
NB100-64775
Flow Cytometry: HLA ABC Antibody (W6/32) [NB100-64775] - Analysis using the PE/Cy5 conjugate of NB100-64775. Staining of normal human peripheral blood cells with Mouse IgG2a K Isotype Control PE-Cy5 (NBP1-43073) (blue histogram) or Anti-Human HLA-ABC PE-Cy5 (purple histogram). Cells in the lymphocyte gate were
Flow Cytometry: HLA ABC Antibody (W6/32) [NB100-64775] - Analysis using the FITC conjugate of NB100-64775. Staining of normal human peripheral blood cells with Mouse IgG2a K Isotype Control FITC (NBP1-43955) (blue histogram) or Anti-Human HLA-ABC FITC (purple histogram). Cells in the lymphocyte gate were used f
Immunohistochemistry-Frozen: HLA ABC Antibody (W6/32) [NB100-64775] - Analysis of Mouse colon cancer tissue using HLA ABC antibody (W6/32). Primary antibody dilution was 1:100. Sample was incubated with secondary antibody in 1:300 dilution. Image from verified customer review.
(2 Reviews)
(27 Publications)
Species: Pm, Bv, Hu, Mu, Pm
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P (-), IP
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(36 Reviews)
(708 Publications)
Species: Hu
Applications: BA
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.Both antibodies were conjugated to phycoerythrin.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(23 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Analysis of Protein Array containing more than 19,000 full-length human proteins using HLA DQ/DR/DP Antibody (HLA-Pan/2967R). Z- and S- Score: The Z-score represents the strength of a signal that a monoclonal antibody (MAb) (in combination with a fluorescently-tagged anti-IgG secondary antibody) produces when binding to a particular protein on the HuProt(TM) array. Z-scores are described in units of standard deviations (SD's) above the mean value of all signals generated on that array. If targets on HuProt(TM) are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD's) between the Z-score. S-score therefore represents the relative target specificity of a MAb to its intended target. A MAb is considered to specific to its intended target, if the MAb has an S-score of at least 2.5.
Immunocytochemistry/Immunofluorescence: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Immunofluorescence staining of Raji cells using HLA DQ/DR/DP Antibody (HLA-Pan/2967R) followed by goat anti-rabbit IgG-CF488 (Green). Nuclei stained with RedDot (Red).
Western Blot: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Western Blot Analysis of Ramos cell lysate using HLA DQ/DR/DP Antibody (HLA-Pan/2967R).
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
CD63 Antibody
(H5C6) - BSA Free
NBP2-42225
Immunocytochemistry/Immunofluorescence: CD63 Antibody (H5C6) [NBP2-42225] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton X-100. The cells were incubated with anti-CD63 [H5C6] conjugated to Alexa Fluor 488 [NBP2-42225AF488] at 10ug/mL for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Flow (Intracellular): CD63 Antibody (H5C6) [NBP2-42225] - An intracellular stain was performed on HepG2 cells with CD63 Antibody (H5C6) NBP2-42225AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Western Blot: CD63 Antibody (H5C6) [NBP2-42225] - The same samples and volumes were run under reducing and non-reducing conditions. All procedures were performed in parallel for both conditions. L- ladder +- exosomes. Image visualized with HRP linked to secondary antibody. Western blot image submitted by a verified customer review.
(5 Reviews)
(38 Publications)
Species: Ca, Hu
Applications: DB, EM, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC-WhMt, IP, In vitro, WB
Vimentin Antibody
NB300-223
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - Analysis of HeLa cell culture. Antibody at 1:10,000 in green, and costained with mouse mAb to actin, dilution 1:500 in red. The blue is DAPI staining of nuclear DNA. The vimentin antibody stains the intermediate filament network while the actin antibody labels the submembranous cytoskeleton, stress fibers, and bundles of actin associated with cell adhesion sites.
Immunohistochemistry-Frozen: Vimentin Antibody [NB300-223] - 10 um Cryosections from PFA fixed murine brain acute slices stained with Vimentin antibody (1:600) and Alexa Fluor 488 anti chicken IgG. Antibody showed specific staining, also of blood vessels. IHC-Fr image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - Human A7 cells. Cells were fixed with 10% formalin and permeabilized with 0.1% TritonX-100. After blocking, cells were incubated with primary antibody (1:600) at 4C O/N followed with Alexa Fluor 488 labeled secondary antibody and counterstained with DAPI and Phalloidin for nuclei and F-actin respectively. Imaged with Leica TCS SP5 confocal microscope. ICC/IF image submitted by a verified customer review.
(6 Reviews)
(54 Publications)
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
MAGEA3 Antibody
(6D10)
H00004102-M01
Western Blot: MAGEA3 Antibody (6D10) [H00004102-M01] - Analysis of MAGEA3 expression in transfected 293T cell line by MAGEA3 monoclonal antibody (M01), clone 6D10.Lane 1: MAGEA3 transfected lysate (Predicted MW: 34.7 KDa).Lane 2: Non-transfected lysate.
Sandwich ELISA: MAGEA3 Antibody (6D10) [H00004102-M01] - Detection limit for recombinant GST tagged MAGEA3 is approximately 0.3ng/ml as a capture antibody.
(2 Publications)
Species: Hu, Mu
Applications: ELISA, IHC, S-ELISA, WB
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen: CD4 Antibody [NBP1-19371] - Staining in mouse liver tissue.
Immunohistochemistry-Paraffin: CD4 Antibody [NBP1-19371] - Alcohol-fixed paraffin-embedded rat spleen tissue. Dilution 1:150. Image from verified customer review.
Flow Cytometry: CD4 Antibody [NBP1-19371] - An intracellular stain was performed on Jurkat cells with CD4 Antibody NBP1-19371R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
(9 Reviews)
(39 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
ICAM-1/CD54
[Unconjugated]
796-IC
ICAM-1/CD54 [Unconjugated]
(1 Review)
(69 Publications)
Species: Mu
Applications: BA
TRP2 Antibody
NBP1-86893
Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86893] - Analysis in human skin and lymph node tissues. Corresponding DCT RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86893] - Staining of human skin shows cytoplasmic positivity in squamous epithelial cells.
Western Blot: TRP2 Antibody [NBP1-86893] - Analysis in human cell line SK-MEL-30 and human cell line U-2 OS.
(1 Review)
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for ZNF654 Antibody (NBP3-10966) (0)

There are no publications for ZNF654 Antibody (NBP3-10966).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF654 Antibody (NBP3-10966) (0)

There are no reviews for ZNF654 Antibody (NBP3-10966). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF654 Antibody (NBP3-10966) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF654 Products

Bioinformatics Tool for ZNF654 Antibody (NBP3-10966)

Discover related pathways, diseases and genes to ZNF654 Antibody (NBP3-10966). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF654 Antibody (NBP3-10966)

Discover more about diseases related to ZNF654 Antibody (NBP3-10966).

Blogs on ZNF654

There are no specific blogs for ZNF654, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF654 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ZNF654