ZNF423 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZNF423 Antibody [NBP2-57466] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF423 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QPDSSNHSVSPDPVLGSVASMSSATPDSSASVERGSTPDSTLKPLRGQKKMRDDGQGWTKV
Specificity
Specificity of human ZNF423 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF423
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF423 Recombinant Protein Antigen (NBP2-57466PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ZNF423 Antibody

  • FLJ20086
  • KIAA1584
  • MGC21637
  • MGC61687
  • SUHW4
  • Suppressor of hairy wing homolog 4
  • zinc finger protein 280D
  • Zinc finger protein 634
  • ZNF634suppressor of hairy wing homolog 4 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001879-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IP, RNAi, S-ELISA
NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85533
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56443
Species: Hu, Mu, Rt
Applications: WB
NBP2-24951
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91271
Species: Hu, Mu
Applications: WB (-), ICC/IF, IHC, IHC-P
AF5869
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IP, ICC
H00005914-M03
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Ma, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
AF7006
Species: Hu, Mu
Applications: WB, IHC
NB100-56440
Species: Hu, Mu, Rt, Pm, Pm, Sh
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB110-41622
Species: Hu, Mu, Rt, Po, Bv, Ch, Gt, Xp
Applications: WB, IHC, IHC-P
NBP1-88837
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for ZNF423 Antibody (NBP2-57466) (0)

There are no publications for ZNF423 Antibody (NBP2-57466).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF423 Antibody (NBP2-57466) (0)

There are no reviews for ZNF423 Antibody (NBP2-57466). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF423 Antibody (NBP2-57466) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZNF423 Products

Bioinformatics Tool for ZNF423 Antibody (NBP2-57466)

Discover related pathways, diseases and genes to ZNF423 Antibody (NBP2-57466). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF423 Antibody (NBP2-57466)

Discover more about diseases related to ZNF423 Antibody (NBP2-57466).
 

Pathways for ZNF423 Antibody (NBP2-57466)

View related products by pathway.

Blogs on ZNF423

There are no specific blogs for ZNF423, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF423 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF423