ZNF318 Antibody

Images

 
Immunohistochemistry-Paraffin: ZNF318 Antibody [NBP1-83209] - Staining of human testis shows distinct nuclear positivity in seminiferous duct cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF318 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IENKGTMVETALKEPQGNLYQWGPLPGIPKDNSPLREKFGSFLCHKDNLDLKAEGPERHTDFLLPHERASQDGSGFSRILSMLADSTSTQEKRRRSFPDIEDEEKFLYGDEEEDLKAESVPKP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF318
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZNF318 Protein (NBP1-83209PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF318 Antibody

  • Zinc finger and SCAN domain-containing protein 15
  • zinc finger protein 397
  • Zinc finger protein 47ZSCAN15MGC13250
  • ZNF47

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
H00027033-B02P
Species: Hu
Applications: WB, ELISA, ICC/IF
2629-FG/CF
Species: Mu
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-35213
Species: Hu
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83209
Species: Hu
Applications: IHC, IHC-P

Publications for ZNF318 Antibody (NBP1-83209) (0)

There are no publications for ZNF318 Antibody (NBP1-83209).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF318 Antibody (NBP1-83209) (0)

There are no reviews for ZNF318 Antibody (NBP1-83209). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ZNF318 Antibody (NBP1-83209) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF318 Products

Bioinformatics Tool for ZNF318 Antibody (NBP1-83209)

Discover related pathways, diseases and genes to ZNF318 Antibody (NBP1-83209). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for ZNF318 Antibody (NBP1-83209)

Find related products by research area.

Blogs on ZNF318

There are no specific blogs for ZNF318, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF318 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF318