Zhangfei Antibody

Images

 
Immunohistochemistry: Zhangfei Antibody [NBP2-13874] - Staining of human cerebellum shows moderate nuclear and cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Zhangfei Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EETEDMDFLSGLELADLLDPRQPDWHLDPGLSSPGPLSSSGGGSDSGGLW RGDDDDEAAAAEMQRFSDLLQRLLNGIGGCSSSSDSGSAEKRRRKSPGGG GGGGSGND
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CREBZF
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Zhangfei Protein (NBP2-13874PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Zhangfei Antibody

  • CREB/ATF bZIP transcription factor
  • FLJ94018
  • HCF-binding transcription factor Zhangfei
  • Host cell factor-binding transcription factor Zhangfei
  • SHP-interacting leucine zipper protein
  • SMILE
  • Zhangfei

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NB100-68209
Species: Hu, Mu
Applications: WB, IP, PLA
H00010488-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-46522
Species: Hu
Applications: WB, IHC
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52911
Species: Hu
Applications: WB, IHC, IHC-P
AF6108
Species: Hu
Applications: IHC
H00000468-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-52405
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IP

Publications for Zhangfei Antibody (NBP2-13874) (0)

There are no publications for Zhangfei Antibody (NBP2-13874).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Zhangfei Antibody (NBP2-13874) (0)

There are no reviews for Zhangfei Antibody (NBP2-13874). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Zhangfei Antibody (NBP2-13874) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Zhangfei Products

Bioinformatics Tool for Zhangfei Antibody (NBP2-13874)

Discover related pathways, diseases and genes to Zhangfei Antibody (NBP2-13874). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Zhangfei Antibody (NBP2-13874)

Discover more about diseases related to Zhangfei Antibody (NBP2-13874).
 

Pathways for Zhangfei Antibody (NBP2-13874)

View related products by pathway.

PTMs for Zhangfei Antibody (NBP2-13874)

Learn more about PTMs related to Zhangfei Antibody (NBP2-13874).

Blogs on Zhangfei

There are no specific blogs for Zhangfei, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Zhangfei Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CREBZF