CTCF Antibody (CL0307)

Images

 
Western Blot: CTCF Antibody (CL0307) [NBP2-52911] - Lane 1: Marker [kDa], Lane 2: Human cell line U-251 MG
Immunocytochemistry/ Immunofluorescence: CTCF Antibody (CL0307) [NBP2-52911] - Staining of MCF7 cells using the Anti-CTCF monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- and ...read more
Immunohistochemistry-Paraffin: CTCF Antibody (CL0307) [NBP2-52911] - Analysis of CTCF antibody on Human fallopian tube tissue. Antigen retrieval was done enzymatically. Image from verified customer review.
Immunohistochemistry-Paraffin: CTCF Antibody (CL0307) [NBP2-52911] - Staining of human endometrium shows strong nuclear positivity in glandular and stromal cells
Immunohistochemistry-Paraffin: CTCF Antibody (CL0307) [NBP2-52911] - Staining of human kidney shows strong nuclear positivity in cells in glomeruli and tubuli.
Immunohistochemistry-Paraffin: CTCF Antibody (CL0307) [NBP2-52911] - Staining of human small intestine shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: CTCF Antibody (CL0307) [NBP2-52911] - Staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clone
CL0307
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CTCF Antibody (CL0307) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMICHTLPLPEGFQVVKVGANGEVETLEQGELPPQEDP
Epitope
TLPLPEGFQV
Predicted Species
Mouse (99%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG2b
Clonality
Monoclonal
Host
Mouse
Gene
CTCF
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 2-10 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 1 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization.
Control Peptide
CTCF Recombinant Protein Antigen (NBP2-52911PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP2-52911 in the following applications:

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for CTCF Antibody (CL0307)

  • 11 zinc finger transcriptional repressor
  • 11-zinc finger protein
  • 11-Zinc Finger Protein2
  • CCCTC-binding factor (zinc finger protein)
  • CCCTC-binding Factor
  • CTCF
  • CTCFL paralog
  • transcriptional repressor CTCF

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

292-G2
Species: Hu
Applications: BA
NBP1-89947
Species: Hu
Applications: IHC, IHC-P
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-30141
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-14081
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-56519
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
NBP2-20053
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
NB100-86989
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP2-20932
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NBP1-84999
Species: Hu
Applications: IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-89917
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56326
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB

Publications for CTCF Antibody (NBP2-52911) (0)

There are no publications for CTCF Antibody (NBP2-52911).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for CTCF Antibody (NBP2-52911) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP2-52911:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin CTCF NBP2-52911
Enlarge
5
reviewed by:
Verified Customer
IHC-P Human 02/21/2022
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample Testedfallopian tube tissue
SpeciesHuman
LotCL0307

Comments

Commentsantigen retrieval was done enzymatically. Incubated O/N in 4 C with the 1ry antibody.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CTCF Antibody (NBP2-52911) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CTCF Products

Bioinformatics Tool for CTCF Antibody (NBP2-52911)

Discover related pathways, diseases and genes to CTCF Antibody (NBP2-52911). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CTCF Antibody (NBP2-52911)

Discover more about diseases related to CTCF Antibody (NBP2-52911).
 

Pathways for CTCF Antibody (NBP2-52911)

View related products by pathway.

PTMs for CTCF Antibody (NBP2-52911)

Learn more about PTMs related to CTCF Antibody (NBP2-52911).
 

Research Areas for CTCF Antibody (NBP2-52911)

Find related products by research area.

Blogs on CTCF

There are no specific blogs for CTCF, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Verified Customer
02/21/2022
Application: IHC-P
Species: Human

Bioinformatics

Gene Symbol CTCF