BORIS Antibody

Images

 
Immunohistochemistry-Paraffin: BORIS Antibody [NBP1-89947] - Staining of human testis shows moderate nuclear positivity in subset of cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BORIS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DGVCREKDHRSPSELEAQRTSGAFQDSVLEEEVELVLAPSEESEKYILTLQTVHFTSEAVELQDMSLLSIQQQEGVQVVVQQPGPGLLWLEEGPRQSLQQCVAISIQQELYSPQEMEVLQFHALEENVMVASEDSKLAVS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CTCFL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
BORIS Protein (NBP1-89947PEP)
Publications
Read Publications using
NBP1-89947 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23592437).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BORIS Antibody

  • BORISHMGB1L1
  • BORIS-like protein
  • Brother of the regulator of imprinted sites
  • Cancer/testis antigen 27
  • CCCTC-binding factor (zinc finger protein)-like
  • CCCTC-binding factor
  • CT27MGC163358
  • CTCF paralog
  • CTCF-like protein
  • CTCF-T
  • dJ579F20.2
  • HMG-1L1
  • MGC169105
  • MGC169106
  • putative high mobility group protein 1-like 1
  • putative high mobility group protein B1-like 1
  • transcriptional repressor CTCFL
  • Zinc finger protein CTCF-T

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52911
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47714
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
NBP1-85431
Species: Hu
Applications: ICC/IF, IHC, IHC-P
17190002
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76539
Species: Hu, Mu
Applications: WB, ELISA, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-558
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP
NBP1-20089
Species: Hu
Applications: WB, ICC/IF
NB100-266
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF5415
Species: Hu
Applications: WB, IHC, ICC
30230002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-87377
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for BORIS Antibody (NBP1-89947)(3)

Reviews for BORIS Antibody (NBP1-89947) (0)

There are no reviews for BORIS Antibody (NBP1-89947). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BORIS Antibody (NBP1-89947) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BORIS Products

Bioinformatics Tool for BORIS Antibody (NBP1-89947)

Discover related pathways, diseases and genes to BORIS Antibody (NBP1-89947). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BORIS Antibody (NBP1-89947)

Discover more about diseases related to BORIS Antibody (NBP1-89947).
 

Pathways for BORIS Antibody (NBP1-89947)

View related products by pathway.

PTMs for BORIS Antibody (NBP1-89947)

Learn more about PTMs related to BORIS Antibody (NBP1-89947).

Blogs on BORIS

There are no specific blogs for BORIS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BORIS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CTCFL