ZBP1/DLM-1/DAI Antibody

Images

 
Immunohistochemistry-Paraffin: ZBP1/DLM-1/DAI Antibody [NBP2-14793] - Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZBP1/DLM-1/DAI Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GHGNIITRQTVSREDGSAGPRHLPSMAPGDSSTWGTLVDPWGPQDIHMER SILRRVQLGHSNEMRLHGVPSEGPAHIPPGSPPVSATAAGPEASFEARIP SPG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZBP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZBP1/DLM-1/DAI Protein (NBP2-14793PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZBP1/DLM-1/DAI Antibody

  • C20orf183
  • chromosome 20 open reading frame 183
  • DAI
  • DLM1
  • DLM-1
  • DLM1dJ718J7.3
  • DNA-dependent activator of interferon regulatory factors
  • DNA-dependent activator of IRFs
  • Tumor stroma and activated macrophage protein DLM-1
  • ZBP1 Z-DNA binding protein 1
  • ZBP1
  • Z-DNA binding protein 1
  • Z-DNA-binding protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PP-H7431-00
Species: Hu
Applications: WB
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NBP1-47812
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24729
Species: Hu, Mu, Rt, Ca, Eq, Pm
Applications: WB, Simple Western, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
NBP2-38956
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
H00009447-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-56705
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBL1-07321
Species: Hu
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
NBP1-77299
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-32276
Species: Hu
Applications: WB, IP

Publications for ZBP1/DLM-1/DAI Antibody (NBP2-14793) (0)

There are no publications for ZBP1/DLM-1/DAI Antibody (NBP2-14793).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZBP1/DLM-1/DAI Antibody (NBP2-14793) (0)

There are no reviews for ZBP1/DLM-1/DAI Antibody (NBP2-14793). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ZBP1/DLM-1/DAI Antibody (NBP2-14793) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZBP1/DLM-1/DAI Products

Bioinformatics Tool for ZBP1/DLM-1/DAI Antibody (NBP2-14793)

Discover related pathways, diseases and genes to ZBP1/DLM-1/DAI Antibody (NBP2-14793). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZBP1/DLM-1/DAI Antibody (NBP2-14793)

Discover more about diseases related to ZBP1/DLM-1/DAI Antibody (NBP2-14793).
 

Pathways for ZBP1/DLM-1/DAI Antibody (NBP2-14793)

View related products by pathway.

PTMs for ZBP1/DLM-1/DAI Antibody (NBP2-14793)

Learn more about PTMs related to ZBP1/DLM-1/DAI Antibody (NBP2-14793).

Blogs on ZBP1/DLM-1/DAI

There are no specific blogs for ZBP1/DLM-1/DAI, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZBP1/DLM-1/DAI Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZBP1
Entrez