YOD1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: YOD1 Antibody [NBP1-84173] - Staining of human cell line A-431 shows localization to nucleoplasm, nuclear bodies & plasma membrane.
Immunohistochemistry-Paraffin: YOD1 Antibody [NBP1-84173] - Staining of human bone marrow shows cytoplasmic positivity in hematopoietic cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

YOD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DMLIIEEDQTRPRSSPAFTKRGASSYVRETLPVLTRTVVPADNSCLFTSVYYVVEGGVLNPACAPEMRRLIAQIVA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
YOD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
YOD1 Protein (NBP1-84173PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for YOD1 Antibody

  • DKFZp451J1719
  • DUBA8
  • DUBA-8
  • DUBA8hsHIN7
  • EC 3.1.2
  • EC 3.4.19.12
  • HIN7
  • HIN-7
  • HIV-1-induced protease 7
  • HsHIN7
  • OTU domain-containing protein 2
  • OTUD2
  • OTUD2OTU domain containing 2
  • PRO0907
  • ubiquitin thioesterase OTU1
  • YOD1 OTU deubiquinating enzyme 1 homolog ( yeast)
  • YOD1 OTU deubiquinating enzyme 1 homolog (S. cerevisiae)
  • YOD1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-00990
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85310
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-40591
Species: Hu
Applications: WB, IHC-P, IP
NBP1-88680
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
H00000439-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-24695
Species: Hu
Applications: WB, IHC-P
NBP1-85785
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-16381
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-448
Species: Hu, Mu, Ca, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
H00011059-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-32083
Species: Hu
Applications: WB, ICC/IF
NBP2-15108
Species: Hu, Mu, Rt
Applications: WB, ChIP, IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-81623
Species: Hu
Applications: IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
AF811
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready

Publications for YOD1 Antibody (NBP1-84173) (0)

There are no publications for YOD1 Antibody (NBP1-84173).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for YOD1 Antibody (NBP1-84173) (0)

There are no reviews for YOD1 Antibody (NBP1-84173). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for YOD1 Antibody (NBP1-84173) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional YOD1 Products

Bioinformatics Tool for YOD1 Antibody (NBP1-84173)

Discover related pathways, diseases and genes to YOD1 Antibody (NBP1-84173). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for YOD1 Antibody (NBP1-84173)

Discover more about diseases related to YOD1 Antibody (NBP1-84173).
 

Pathways for YOD1 Antibody (NBP1-84173)

View related products by pathway.

Blogs on YOD1

There are no specific blogs for YOD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our YOD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol YOD1
Entrez