Ancient ubiquitous protein 1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Ancient ubiquitous protein 1 Antibody [NBP1-85785] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Analysis in human cell line RPMI-8226.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Ancient ubiquitous protein 1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Ancient ubiquitous protein 1 Antibody - BSA Free (NBP1-85785) is a polyclonal antibody validated for use in IHC and WB. Anti-Ancient ubiquitous protein 1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LLWSLFVPFTVYQVRWLRPVHRQLGEANEEFALRVQQLVAKELGQTGTRLTPADKAEHMKRQRHPRLRPQSAQSSFPPSPGPSPDVQLATLAQRVKEVLPHVPLGVIQRDLAKTGCVDLTITNLLEGAVAFMPEDITKGTQSLPT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AUP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Ancient ubiquitous protein 1 Protein (NBP1-85785PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Ancient ubiquitous protein 1 Antibody - BSA Free

• ancient ubiquitous protein 1

Background

Ancient ubiquitous protein 1 encodes a protein that contains a domain with homology to the ancient conserved region of the archain 1 gene and a domain that may be involved in binding ubiquitin-conjugating enzymes. The protein encoded by this gene has been shown to bind to the conserved membrane-proximal sequence of the cytoplasmic tail of integrin alpha(IIb) subunits. These subunits play a crucial role in the integrin alpha(IIb)beta(3) inside-out signaling in platelets and megakaryocytes that leads to platelet aggregation and thrombus formation. This gene overlaps the gene for mitochondrial serine protease 25.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Ancient ubiquitous protein 1 Antibody (NBP1-85785)(1)

Publication using NBP1-85785

• Hartman IZ, Liu P, Zehmer JK et al. Sterol-induced dislocation of 3-hydroxy-3-methylglutaryl coenzyme A reductase from endoplasmic reticulum membranes into the cytosol through a subcellular compartment resembling lipid droplets. J Biol Chem 2010-06-18 [PMID: 20406816]

Bioinformatics

• Gene Symbol: AUP1
• Entrez:
  • 550(Human)
• Uniprot:
  • Q9Y679(Human)