AAAS Antibody (5A1) (H00008086-M02)

Images

 
Western Blot: AAAS Antibody (5A1) [H00008086-M02] - AAAS monoclonal antibody (M02), clone 5A1. Analysis of AAAS expression in NIH/3T3.
Immunohistochemistry-Paraffin: AAAS Antibody (5A1) [H00008086-M02] - Analysis of monoclonal antibody to AAAS on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml.
Western Blot: AAAS Antibody (5A1) [H00008086-M02] - Western Blot analysis of AAAS expression in HeLa ( Cat # L013V1 ).
Western Blot: AAAS Antibody (5A1) [H00008086-M02] - AAAS monoclonal antibody (M02), clone 5A1. Analysis of AAAS expression in PC-12.
Western Blot: AAAS Antibody (5A1) [H00008086-M02] - AAAS monoclonal antibody (M02), clone 5A1. Analysis of AAAS expression in Jurkat.
Western Blot: AAAS Antibody (5A1) [H00008086-M02] - Analysis of AAAS expression in transfected 293T cell line by AAAS monoclonal antibody (M02), clone 5A1.Lane 1: AAAS transfected lysate (Predicted MW: 59.6 KDa).Lane 2: ...read more
ELISA: AAAS Antibody (5A1) [H00008086-M02] - Detection limit for recombinant GST tagged AAAS is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
5A1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

AAAS Antibody (5A1) Summary

Immunogen
AAAS (NP_056480, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MCSLGLFPPPPPRGQVTLYEHNNELVTGSSYESPPPDFRGQWINLPVLQLTKDPLKTPGRLDHGTRTAFIHHREQVWKRCINIWRDVGLFGVLNEIANSE
Specificity
AAAS - achalasia, adrenocortical insufficiency, alacrimia (Allgrove, triple-A)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
AAAS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA and IHC-P.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AAAS Antibody (5A1)

  • AAA
  • AAASb
  • achalasia, adrenocortical insufficiency, alacrimia (Allgrove, triple-A)
  • achalasia, adrenocortical insufficiency, alacrimia
  • ADRACALA
  • Adracalin
  • ALADIN
  • Allgrove, triple-A
  • DKFZp586G1624

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-26618
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
NBP1-90230
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-85310
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-40591
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88680
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00990
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87377
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-69295
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P

Publications for AAAS Antibody (H00008086-M02) (0)

There are no publications for AAAS Antibody (H00008086-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AAAS Antibody (H00008086-M02) (0)

There are no reviews for AAAS Antibody (H00008086-M02). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AAAS Antibody (H00008086-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AAAS Products

Related Products by Gene

Bioinformatics Tool for AAAS Antibody (H00008086-M02)

Discover related pathways, diseases and genes to AAAS Antibody (H00008086-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AAAS Antibody (H00008086-M02)

Discover more about diseases related to AAAS Antibody (H00008086-M02).
 

Pathways for AAAS Antibody (H00008086-M02)

View related products by pathway.

Blogs on AAAS

There are no specific blogs for AAAS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AAAS Antibody (5A1) and receive a gift card or discount.

Bioinformatics

Gene Symbol AAAS
Entrez
OMIM
Uniprot