Home » AAAS » AAAS Antibodies » AAAS Antibody (5A1)

AAAS Antibody (5A1)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: AAAS Antibody (5A1) [H00008086-M02] - AAAS monoclonal antibody (M02), clone 5A1. Analysis of AAAS expression in NIH/3T3.
Western Blot: AAAS Antibody (5A1) [H00008086-M02] - AAAS monoclonal antibody (M02), clone 5A1. Analysis of AAAS expression in NIH/3T3.
Immunohistochemistry-Paraffin: AAAS Antibody (5A1) [H00008086-M02] - Analysis of monoclonal antibody to AAAS on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml.
Western Blot: AAAS Antibody (5A1) [H00008086-M02] - Western Blot analysis of AAAS expression in HeLa ( Cat # L013V1 ).
Western Blot: AAAS Antibody (5A1) [H00008086-M02] - AAAS monoclonal antibody (M02), clone 5A1. Analysis of AAAS expression in PC-12.
Western Blot: AAAS Antibody (5A1) [H00008086-M02] - AAAS monoclonal antibody (M02), clone 5A1. Analysis of AAAS expression in Jurkat.
Western Blot: AAAS Antibody (5A1) [H00008086-M02] - Analysis of AAAS expression in transfected 293T cell line by AAAS monoclonal antibody (M02), clone 5A1.Lane 1: AAAS transfected lysate (Predicted MW: 59.6 KDa).Lane 2: ...read more
ELISA: AAAS Antibody (5A1) [H00008086-M02] - Detection limit for recombinant GST tagged AAAS is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA
Clone
5A1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

AAAS Antibody (5A1) Summary

Immunogen
AAAS (NP_056480, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MCSLGLFPPPPPRGQVTLYEHNNELVTGSSYESPPPDFRGQWINLPVLQLTKDPLKTPGRLDHGTRTAFIHHREQVWKRCINIWRDVGLFGVLNEIANSE
Specificity
AAAS - achalasia, adrenocortical insufficiency, alacrimia (Allgrove, triple-A)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
AAAS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA and IHC-P.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AAAS Antibody (5A1)

  • AAA
  • AAASb
  • achalasia, adrenocortical insufficiency, alacrimia (Allgrove, triple-A)
  • achalasia, adrenocortical insufficiency, alacrimia
  • ADRACALA
  • Adracalin
  • ALADIN
  • Allgrove, triple-A
  • DKFZp586G1624

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

p97/VCP Antibody
NB100-1558
Western Blot: p97/VCP Antibody [NB100-1558] - Zymographic assay of gelatinase activity. Medium supernatants of 20ml culture medium (medium control) as well as 20 ml conditioned medium from 107 U937 cells, pMTH1-U937 cells and asCD11b-U937 cells in the absence or presence of 5nM TPA for 72 h, respectively, were 18-fold concentrated and subjected to SDS-PAGE containing 2 mg/ml of gelatine. Following incubation with MMP enzyme buffer, the gels were stained with 0.4% Coomassie blue and afterwards destained again to visualize the appearance of gelatinase activity by light bands against the dark background. The molecular weight markers on both sides of the gels indicate the size of the MMPs exhibiting gelatinase activities. Image collected and cropped by CiteAb from the following publication (http://biosignaling.biomedcentral.com/articles/10.1186/1478-811X-10-13) licensed under a CC-BY licence.
Western Blot: p97/VCP Antibody [NB100-1558] - Whole cell lysate (15 ug) from HeLa, 293T, Jurkat, mouse TCMK-1, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit antiVCP antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 1 second.
Western Blot: p97/VCP Antibody [NB100-1558] - Detection of human VCP by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-VCP antibody NB100-1558 used for IP at 3 ug per reaction. VCP was also immunoprecipitated by rabbit anti-VCP antibody NB100-1557. For blotting immunoprecipitated VCP, NB100-1558 was used at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 1 second.
(10 Publications)
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
BRCAA1 Antibody
NBP1-26618
Western Blot: BRCAA1 Antibody [NBP1-26618] - Whole cell lysate from HeLa cells. ARID4B was also immunoprecipitated by rabbit anti-ARID4B antibody NBP1-26619.
Immunohistochemistry: BRCAA1 Antibody [NBP1-26618] - Sample: FFPE section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti-ARID4B used at a dilution of 1:1,000 ( 1ug/ml). Detection: DAB staining using Immunohistochemistry Accessory Kit.
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP
MMP-9 [HRP]
DMP900
(7 Reviews)
(164 Publications)
Species: Hu
Elastin Antibody
(BA-4)
NB100-2076
Western Blot: Elastin Antibody (BA-4) [NB100-2076] - Analysis of tropoelastin using the mAb BA-4 elastin antibody (NB100-2076). A: Western blot of tropoelastin purified from bovine ligamentum nuchae tissue minces. B: Autoradiogram of a gradient SDS-polyacrylamide gel showing [3H] leucine-labeled tropoelasti.
Immunohistochemistry-Paraffin: Elastin Antibody (BA-4) [NB100-2076] - Presence of ECM proteins collagen, elastin, fibronectin, vitronectin and GAGs following decellularization. Porcine vena cavas were decellularized and analyzed for ECM proteins. Cross-section of paraffin embedded samples were immunostained for collagen type I/III, elastin, fibronectin and vitronectin. Images were taken at identical microscopy settings. Scale bar is 100 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0220743), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Elastin Antibody (BA-4) [NB100-2076] - Elastin surrounding blood vessel in pig testis. Image from verified customer review.
(2 Reviews)
(5 Publications)
Species: Hu, Po, Ca, Fe, Gt, Gp, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Spastin Antibody
NBP1-90230
Western Blot: Spastin Antibody [NBP1-90230] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-550
Immunocytochemistry/Immunofluorescence: Spastin Antibody [NBP1-90230] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Spastin Antibody [NBP1-90230] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
IL-6 [HRP]
D6050
(25 Reviews)
(463 Publications)
Species: Hu
MMP-2 [HRP]
MMP200
(1 Review)
(61 Publications)
Species: Hu, Mu, Rt, Po, Ca
Albumin Antibody
NB600-41532
Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: Albumin Antibody [NB600-41532] - NLRP12 downregulates multiple JNK activating pathways in hepatocytes. For checking the purity of primary hepatocytes, hepatocytes isolated from healthy WT and Nlrp12-/- mouse livers were immunostained with antibody for hepatocyte-specific marker Albumin and counterstained with DAPI. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/40396), licensed under a CC-BY licence.
(37 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Angiotensin II/III
Antibody (Ang II E7 ( ...
NB100-62346
Western Blot: Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) [NB100-62346] - Protein expressions of intrarenal RAS components in two groups of mice. Western blot analysis for protein expressions of intrarenal RAS components in the two groups of mice. Image collected and cropped by CiteAb from the following publication (lipidworld.biomedcentral.com/articles/10.1186/1476-511X-12-49), licensed under a CC-BY licence.
Immunohistochemistry: Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) [NB100-62346] - Protein expressions of intrarenal RAS components in two groups of mice. (A) Immunohistochemical analysis of intrarenal RAS expression position in the two groups of mice. AGT immunoreactivity in the proximal tubular cells, Ang II immunoreactivity in both glomerular and tubular cells, renin immunoreactivity in juxtaglomerular apparatus cells, ACE immunoreactivity in brush border membranes of proximal tubules as well as AT1 and AT2 immunoreactivity in the proximal tubules were increased in the HF group when compared to the control group. Image collected and cropped by CiteAb from the following publication (lipidworld.biomedcentral.com/articles/10.1186/1476-511X-12-49), licensed under a CC-BY licence.
Western Blot: Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) [NB100-62346] - Evaluation of angiotensis II expression in untreated UUO rat kidneys and UUO rat kidneys treated with Ang-(1-7).
(13 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(32 Reviews)
(645 Publications)
Species: Hu
POMC Antibody
NB100-1533
Western Blot: POMC Antibody [NB100-1533] - Staining of NIH3T3 cell lysate with antibody at 0.3 ug/mL (A) and Rat Brain cell lysate with antibody at 2 ug/mL (B). 35 ug protein in RIPA buffer. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: POMC Antibody [NB100-1533] - Staining of paraffin embedded Human Pituitary Gland. Antibody at 2 ug/mL. Steamed antigen retrieval with Tris/EDTA buffer pH 9, HRP-staining.
Flow Cytometry: POMC Antibody [NB100-1533] - Flow cytometric analysis of paraformaldehyde fixed A431 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
(10 Publications)
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
DAP5 Antibody
(39C534.1)
NB120-11929
Western Blot: DAP5 Antibody (39C534.1) [NB120-11929] - Analysis of NB120-11929 (1ug) on 15 ug of total cell lysate from Jurkat cells.
Flow Cytometry: DAP5 Antibody (39C534.1) [NB120-11929] - Intracellular flow cytometric staining of 1 x 10^6 CHO (A) and HEK-293 (B) cells using antibody (dark blue). Isotype control shown in orange. An antibody concentration of 1 ug/1x10^6 cells was used.
(2 Publications)
Species: Hu, Mu
Applications: WB, Flow
Gemin 4 Antibody
NB110-40591
Western Blot: Gemin 4 Antibody [NB110-40591] - Whole cell lysate from HeLa (5, 15 and 50 mcg for WB; 1 mg for IP, 20% of IP loaded) and 293T (T; 50 mcg) cells. NB110-40591 used for WB at 0.04 mcg/ml (A) and 1 mcg/ml (B) and used for IP at 3 mcg/mg lysate (B).
Immunohistochemistry-Paraffin: Gemin 4 Antibody [NB110-40591] - Human breast carcinoma. Antibody used at a dilution of 1:200.
Species: Hu
Applications: WB, IHC, IHC-P, IP
Craniofacial
Development Protein 1 ...
NBP2-43760
Western Blot: Craniofacial Development Protein 1 Antibody (12411) [NBP2-43760] - Analysis of A. 5 ug 293T whole cell lysate/extract B. 5 ug whole cell lysate/extract of human CFDP1-transfected 293T cells 12 % SDS-PAGE CFDP1 antibody [12411] dilution: 1:5000.
Immunocytochemistry/Immunofluorescence: Craniofacial Development Protein 1 Antibody (12411) [NBP2-43760] - CFDP1 Antibody (12411) detects CFDP1 protein at nucleus by immunofluorescent analysis. Sample: HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min.Green: CFDP1 stained by CFDP1 antibody (12411) diluted at 1:500. Red: alpha Tubulin 4a, a cytoskeleton marker, stained by alpha Tubulin 4a antibody diluted at 1:500. Scale bar= 10um.
Immunohistochemistry-Paraffin: Craniofacial Development Protein 1 Antibody (12411) [NBP2-43760] - CFDP1 antibody (12411) detects CFDP1 protein at nucleus by immunohistochemical analysis. Sample: Paraffin-embedded human ovarian cancer. CFDP1 stained by CFDP1 antibody (12411) diluted at 1:1000.
Species: Hu
Applications: WB, ICC/IF, IHC-Fr, IHC-P
Proteasome 19S 10B
Antibody (OTI1G6)
NBP2-00990
Western Blot: Proteasome 19S 10B Antibody (1G6) [NBP2-00990] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Proteasome 19S 10B (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Proteasome 19S 10B.
Immunocytochemistry/Immunofluorescence: Proteasome 19S 10B Antibody (1G6) [NBP2-00990] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Proteasome 19S 10B.
Immunohistochemistry-Paraffin: Proteasome 19S 10B Antibody (1G6) [NBP2-00990] - Staining of paraffin-embedded Human pancreas tissue using anti-Proteasome 19S 10B mouse monoclonal antibody.
Species: Hu, Mu, Rt, Ca, Pm, Pm
Applications: WB, ICC/IF, IHC, IHC-P
C-Reactive
Protein/CRP [HRP]
DCRP00
(3 Reviews)
(83 Publications)
Species: Hu
Teashirt homolog 1
Antibody
NBP1-87377
Western Blot: Teashirt homolog 1 Antibody [NBP1-87377] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-574
Immunocytochemistry/Immunofluorescence: Teashirt homolog 1 Antibody [NBP1-87377] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Teashirt homolog 1 Antibody [NBP1-87377] - Staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
LYAG/GAA Antibody
NBP2-38142
Western Blot: LYAG/GAA Antibody [NBP2-38142] - Analysis in control (vector only transfected HEK293T lysate) and GAA over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: LYAG/GAA Antibody [NBP2-38142] - Staining of human prostate shows moderate positivity in lysosomes in glandular cells.
Immunohistochemistry-Paraffin: LYAG/GAA Antibody [NBP2-38142] - Analysis in human placenta and tonsil tissues. Corresponding GAA RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, IHC, IHC-P
Recombinant Human
AGA Protein
NBP2-52631
SDS-Page: Recombinant Human AGA Protein [NBP2-52631]
(1 Publication)
Species: Hu
AAAS Antibody (5A1)
H00008086-M02
AAAS Antibody (5A1)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, S-ELISA

Publications for AAAS Antibody (H00008086-M02) (0)

There are no publications for AAAS Antibody (H00008086-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AAAS Antibody (H00008086-M02) (0)

There are no reviews for AAAS Antibody (H00008086-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AAAS Antibody (H00008086-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional AAAS Products

Bioinformatics Tool for AAAS Antibody (H00008086-M02)

Discover related pathways, diseases and genes to AAAS Antibody (H00008086-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AAAS Antibody (H00008086-M02)

Discover more about diseases related to AAAS Antibody (H00008086-M02).
 

Pathways for AAAS Antibody (H00008086-M02)

View related products by pathway.

Blogs on AAAS

There are no specific blogs for AAAS, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AAAS Antibody (5A1) and receive a gift card or discount.


Bioinformatics

Gene Symbol AAAS
Entrez
OMIM
Uniprot