Home » AAAS » AAAS Antibodies » AAAS Antibody (5A1)

AAAS Antibody (5A1)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: AAAS Antibody (5A1) [H00008086-M02] - AAAS monoclonal antibody (M02), clone 5A1. Analysis of AAAS expression in NIH/3T3.
Western Blot: AAAS Antibody (5A1) [H00008086-M02] - AAAS monoclonal antibody (M02), clone 5A1. Analysis of AAAS expression in NIH/3T3.
Immunohistochemistry-Paraffin: AAAS Antibody (5A1) [H00008086-M02] - Analysis of monoclonal antibody to AAAS on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml.
Western Blot: AAAS Antibody (5A1) [H00008086-M02] - Western Blot analysis of AAAS expression in HeLa ( Cat # L013V1 ).
Western Blot: AAAS Antibody (5A1) [H00008086-M02] - AAAS monoclonal antibody (M02), clone 5A1. Analysis of AAAS expression in PC-12.
Western Blot: AAAS Antibody (5A1) [H00008086-M02] - AAAS monoclonal antibody (M02), clone 5A1. Analysis of AAAS expression in Jurkat.
Western Blot: AAAS Antibody (5A1) [H00008086-M02] - Analysis of AAAS expression in transfected 293T cell line by AAAS monoclonal antibody (M02), clone 5A1.Lane 1: AAAS transfected lysate (Predicted MW: 59.6 KDa).Lane 2: ...read more
ELISA: AAAS Antibody (5A1) [H00008086-M02] - Detection limit for recombinant GST tagged AAAS is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
5A1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

AAAS Antibody (5A1) Summary

Immunogen
AAAS (NP_056480, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MCSLGLFPPPPPRGQVTLYEHNNELVTGSSYESPPPDFRGQWINLPVLQLTKDPLKTPGRLDHGTRTAFIHHREQVWKRCINIWRDVGLFGVLNEIANSE
Specificity
AAAS - achalasia, adrenocortical insufficiency, alacrimia (Allgrove, triple-A)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
AAAS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA and IHC-P.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AAAS Antibody (5A1)

  • AAA
  • AAASb
  • achalasia, adrenocortical insufficiency, alacrimia (Allgrove, triple-A)
  • achalasia, adrenocortical insufficiency, alacrimia
  • ADRACALA
  • Adracalin
  • ALADIN
  • Allgrove, triple-A
  • DKFZp586G1624

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

p97/VCP Antibody
NB100-1558
Western Blot: p97/VCP Antibody [NB100-1558] - Whole cell lysate (15 ug) from HeLa, 293T, Jurkat, mouse TCMK-1, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit antiVCP antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 1 second.
p97/VCP Antibody [NB100-1558] - Detection of human VCP by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-VCP antibody NB100-1558 used for IP at 3 ug per reaction. VCP was also immunoprecipitated by rabbit anti-VCP antibody NB100-1557. For blotting immunoprecipitated VCP, NB100-1558 was used at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 1 second.
(9 Publications)
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC-Fr, IP
BRCAA1 Antibody
NBP1-26618
Western Blot: BRCAA1 Antibody [NBP1-26618] - Whole cell lysate from HeLa cells. ARID4B was also immunoprecipitated by rabbit anti-ARID4B antibody NBP1-26619.
Immunohistochemistry: BRCAA1 Antibody [NBP1-26618] - Sample: FFPE section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti-ARID4B used at a dilution of 1:1,000 ( 1ug/ml). Detection: DAB staining using Immunohistochemistry Accessory Kit.
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP
Elastin Antibody
(BA-4)
NB100-2076
Western Blot: Elastin Antibody (BA-4) [NB100-2076] - Analysis of tropoelastin using the mAb BA-4 elastin antibody (NB100-2076). A: Western blot of tropoelastin purified from bovine ligamentum nuchae tissue minces. B: Autoradiogram of a gradient SDS-polyacrylamide gel showing [3H] leucine-labeled tropoelasti.
Immunohistochemistry-Paraffin: Elastin Antibody (BA-4) [NB100-2076] - Formalin fixed paraffin embedded human kidney stained with Elastin antibody.
Immunohistochemistry-Paraffin: Elastin Antibody (BA-4) [NB100-2076] - Elastin surrounding blood vessel in pig testis. Image from verified customer review.
(2 Reviews)
(3 Publications)
Species: Hu, Po, Ca, Fe, Gt, GP, Rb, Sh
Applications: WB, IHC, IHC-Fr, IHC-P
Spastin Antibody
NBP1-90230
Western Blot: Spastin Antibody [NBP1-90230] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-550
Immunocytochemistry/Immunofluorescence: Spastin Antibody [NBP1-90230] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Spastin Antibody [NBP1-90230] - Staining of human kidney shows moderate positivity in cytoplasm and membranes of tubular cells.
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
IL-6 [Unconjugated]
7270-IL/CF
IL-6 [Unconjugated]
Species: Hu
Albumin Antibody
NB600-41532
Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.
(41 Publications)
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Serpin
A8/Angiotensinogen An
NBP1-30027
Western Blot: Serpin A8/Angiotensinogen Antibody [NBP1-30027] - Analysis of Angiotensinogen in human kidney lysate.
Immunocytochemistry/Immunofluorescence: Serpin A8/Angiotensinogen Antibody [NBP1-30027] - HepG2 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-Angiotensinogen at 10 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: Serpin A8/Angiotensinogen Antibody [NBP1-30027] - Analysis of Angiotensinogen in mouse kidney using DAB with hematoxylin counterstain.
(6 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(24 Reviews)
(584 Publications)
Species: Hu
POMC Antibody
NB100-1533
Western Blot: POMC Antibody [NB100-1533] - Staining of NIH3T3 cell lysate (35 ug protein in RIPA buffer). Antibody at 0.3 ug/mL. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: POMC Antibody [NB100-1533] - Staining of paraffin embedded Human Pituitary Gland. Antibody at 2 ug/mL. Steamed antigen retrieval with Tris/EDTA buffer pH 9, HRP-staining.
(9 Publications)
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
DAP5 Antibody
NBP1-85311
Western Blot: DAP5 Antibody [NBP1-85311] - Analysis using Anti-EIF4G2 antibody NBP1-85311 (A) shows similar pattern to independent antibody NBP1-85310 (B).
Immunocytochemistry/Immunofluorescence: DAP5 Antibody [NBP1-85311] - Staining of human cell line U-2 OS shows positivity in cytoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DAP5 Antibody [NBP1-85311] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Gemin 4 Antibody
NB110-40591
Western Blot: Gemin 4 Antibody [NB110-40591] - Whole cell lysate from HeLa (5, 15 and 50 mcg for WB; 1 mg for IP, 20% of IP loaded) and 293T (T; 50 mcg) cells. NB110-40591 used for WB at 0.04 mcg/ml (A) and 1 mcg/ml (B) and used for IP at 3 mcg/mg lysate (B).
Immunohistochemistry-Paraffin: Gemin 4 Antibody [NB110-40591] - Human breast carcinoma. Antibody used at a dilution of 1:200.
Species: Hu
Applications: WB, IHC, IHC-P, IP
Craniofacial
Development Protein 1 ...
NBP2-43772
Western Blot: Craniofacial Development Protein 1 Antibody (11811) [NBP2-43772] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with CFDP1 antibody [11811].
Immunohistochemistry-Paraffin: Craniofacial Development Protein 1 Antibody (11811) [NBP2-43772] - Paraffin-embedded human ovarian cancer. CFDP1 stained by CFDP1 antibody [11811] diluted at 1:2000.
Western Blot: Craniofacial Development Protein 1 Antibody (11811) [NBP2-43772] - Analysis of A U87-MG whole cell lysate/extract B SK-N-SH whole cell lysate/extract C IMR32 whole cell lysate/extract D SK-N-AS whole cell lysate/extract 12 % SDS-PAGE CFDP1 antibody [11811] dilution: 1:1000
Species: Hu
Applications: WB, IHC, IHC-P
Proteasome 19S 10B
Antibody (OTI1G6)
NBP2-00990
Western Blot: Proteasome 19S 10B Antibody (1G6) [NBP2-00990] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Proteasome 19S 10B (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Proteasome 19S 10B.
Immunocytochemistry/Immunofluorescence: Proteasome 19S 10B Antibody (1G6) [NBP2-00990] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Proteasome 19S 10B.
Immunohistochemistry-Paraffin: Proteasome 19S 10B Antibody (1G6) [NBP2-00990] - Staining of paraffin-embedded Human pancreas tissue using anti-Proteasome 19S 10B mouse monoclonal antibody.
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Teashirt homolog 1
Antibody
NBP1-87377
Western Blot: Teashirt homolog 1 Antibody [NBP1-87377] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-574
Immunocytochemistry/Immunofluorescence: Teashirt homolog 1 Antibody [NBP1-87377] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Teashirt homolog 1 Antibody [NBP1-87377] - Staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
LYAG/GAA Antibody
NBP2-38142
Western Blot: LYAG/GAA Antibody [NBP2-38142] - Analysis in control (vector only transfected HEK293T lysate) and GAA over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: LYAG/GAA Antibody [NBP2-38142] - Staining of human placenta shows weak to moderate positivity in lysosomes in trophoblastic cells.
Immunohistochemistry-Paraffin: LYAG/GAA Antibody [NBP2-38142] - Analysis in human placenta and tonsil tissues. Corresponding GAA RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, IHC, IHC-P
AGA Antibody
NBP1-88866
Immunohistochemistry-Paraffin: AGA Antibody [NBP1-88866] - Staining in human epididymis and skeletal muscle tissues using anti-AGA antibody. Corresponding AGA RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: AGA Antibody [NBP1-88866] - Staining of human epididymis shows high expression.
Immunohistochemistry-Paraffin: AGA Antibody [NBP1-88866] - Staining of human skeletal muscle shows low expression as expected.
Species: Hu
Applications: IHC, IHC-P

Publications for AAAS Antibody (H00008086-M02) (0)

There are no publications for AAAS Antibody (H00008086-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AAAS Antibody (H00008086-M02) (0)

There are no reviews for AAAS Antibody (H00008086-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AAAS Antibody (H00008086-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AAAS Products

Bioinformatics Tool for AAAS Antibody (H00008086-M02)

Discover related pathways, diseases and genes to AAAS Antibody (H00008086-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AAAS Antibody (H00008086-M02)

Discover more about diseases related to AAAS Antibody (H00008086-M02).
 

Pathways for AAAS Antibody (H00008086-M02)

View related products by pathway.

Blogs on AAAS

There are no specific blogs for AAAS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AAAS Antibody (5A1) and receive a gift card or discount.


Bioinformatics

Gene Symbol AAAS
Entrez
OMIM
Uniprot