DNA Polymerase beta Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: DNA Polymerase beta Antibody [NBP2-38600] - Staining in human testis and liver tissues using anti-POLB antibody. Corresponding POLB RNA-seq data are presented ...read more
Western Blot: DNA Polymerase beta Antibody [NBP2-38600] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: DNA Polymerase beta Antibody [NBP2-38600] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DNA Polymerase beta Antibody [NBP2-38600] - Staining of human liver shows low expression as expected.
Immunohistochemistry: DNA Polymerase beta Antibody [NBP2-38600] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

DNA Polymerase beta Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POLB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DNA Polymerase beta Protein (NBP2-38600PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP2-38600 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DNA Polymerase beta Antibody

  • DNA pol beta
  • DNA polymerase beta subunit
  • DNA Polymerase beta
  • EC 2.7.7.7
  • EC 4.2.99.-
  • MGC125976
  • POLB
  • polymerase (DNA directed), beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-116
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, PLA, Simple Western, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NB100-81665
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB (-)
NBP2-31368
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-150
Species: Hu, Mu
Applications: ChIP, ICC/IF, IP, WB
NBP2-27335
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
NBP1-87154
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB100-106
Species: Hu, Mu, Po, Pm, Rb, Rt
Applications: ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-87720
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-52300
Species: Hu, Mu
Applications: ICC, ICC/IF, IHC, IHC-P, WB
NBP2-16182
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-57664
Species: Hu
Applications: ICC/IF, WB
NB100-119
Species: Ba, Ch, Fi, Ha, Hu, Mu, Rb
Applications: ICC/IF, IHC-P, IP, In vitro, RIA, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Publications for DNA Polymerase beta Antibody (NBP2-38600) (0)

There are no publications for DNA Polymerase beta Antibody (NBP2-38600).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for DNA Polymerase beta Antibody (NBP2-38600) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP2-38600:
Filter by Applications
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
 DNA Polymerase beta NBP2-38600
Enlarge
5
reviewed by:
Verified Customer
Human 03/24/2017
View

Summary

Sample TestedGenomic DNA samples from LN428 cells -treated by copper complex to induce DNA-protein cross-links
SpeciesHuman
LotR59007

Comments

CommentsAfter the rabbit anti-DNA polymerase beta antibody from Novus Biologicals NB100-91734, which this lab has been using for DPC assay, being discontinued by Novus biologicals, we have been looking for an available antibody for the application of DPC assay.

LN428 human cancer cells were treated by 100 uM of 1,10-Phenanthroline-Copper (II) complex to induce genomic DNA damages (DNA-protein cross-links); a serial of amount of gDNA samples (0, 200, 500, 1000 and 2000ng) were prepared and gDNA samples were blotted onto nitrocellulose membrane and probed for DNA polymerase beta which was trapped on the sites of gDNA damages.

The NBP2-38600 antibody was compared with the discontinued DNA Polymerase beta antibody NB100-91734, which we have been using and has been working very well for DPC assay,

The result showed that NBP2-38600 worked as good as, or evenbetter than, the discontinued NB100-91734.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DNA Polymerase beta Antibody (NBP2-38600) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNA Polymerase beta Products

Bioinformatics Tool for DNA Polymerase beta Antibody (NBP2-38600)

Discover related pathways, diseases and genes to DNA Polymerase beta Antibody (NBP2-38600). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNA Polymerase beta Antibody (NBP2-38600)

Discover more about diseases related to DNA Polymerase beta Antibody (NBP2-38600).
 

Pathways for DNA Polymerase beta Antibody (NBP2-38600)

View related products by pathway.

PTMs for DNA Polymerase beta Antibody (NBP2-38600)

Learn more about PTMs related to DNA Polymerase beta Antibody (NBP2-38600).
 

Research Areas for DNA Polymerase beta Antibody (NBP2-38600)

Find related products by research area.

Blogs on DNA Polymerase beta.

PARP Antibody Assays aid both Apoptosis and Cancer Research
The PARP (Poly(ADP-ribose) polymerase) protein is a zinc-dependant nuclear enzyme whose main role is to detect and repair DNA single-strand breaks (SSB). However, PARP antibody research has revealed there are at least 17 PARP proteins, which also play...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Verified Customer
03/24/2017
Application:
Species: Human

Bioinformatics

Gene Symbol POLB
Uniprot