Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: YCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE |
Predicted Species | Mouse (97%), Rat (97%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | POLB |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
Control Peptide |
|
||
Reviewed Applications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Images | Ratings | Applications | Species | Date | Details | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
![]() Enlarge |
reviewed by:
Meiyi Tang |
Slot blot DPC assay | Human | 03/24/2017 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Diseases for DNA Polymerase beta Antibody (NBP2-38600)Discover more about diseases related to DNA Polymerase beta Antibody (NBP2-38600).
| Pathways for DNA Polymerase beta Antibody (NBP2-38600)View related products by pathway.
|
PARP Antibody Assays aid both Apoptosis and Cancer Research The PARP (Poly(ADP-ribose) polymerase) protein is a zinc-dependant nuclear enzyme whose main role is to detect and repair DNA single-strand breaks (SSB). However, PARP antibody research has revealed there are at least 17 PARP proteins, which also play... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
Meiyi Tang 03/24/2017 |
||
Application: | Slot blot DPC assay | |
Species: | Human |