WT1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: WT1 Antibody [NBP2-56086] - Staining of human cell line PC-3 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

ChIP-Exo-Seq composite graph for Anti-WT1 (NBP2-56086) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

WT1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit WT1 Antibody - BSA Free (NBP2-56086) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PHSFIKQEPSWGGAEPHEEQCLSAFTVHFSGQFTGTAGACRYGPFGPPPPSQASSGQARMFPNAPYLPSCLESQPAIRNQGY
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WT1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  WT1 Recombinant Protein Antigen (NBP2-56086PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for WT1 Antibody - BSA Free

• AWT1
• GUD
• NPHS4GUD
• WAGR
• Wilms tumor 1
• Wilms tumor protein
• WIT-2
• WT1
• WT33

Background

Wilms' tumor protein (WT1) is a transcription factor which regulates the expression of numerous target genes, including EPO. This protein plays an essential role in the normal development of the urogenital system, including cellular development and cell survival, and it has both tumor suppressor and oncogenic roles in tumor formation.

Defects in the WT1 protein can lead to Wilms tumor, Frasier syndrome, Denys-Drash syndrome, nephrotic syndrome type 4, and Meacham syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: WT1