Wnt-7a Antibody

Images

 
Immunohistochemistry-Paraffin: WNT7A Antibody [NBP1-86071] - Staining of human testis shows strong membrane and cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Wnt-7a Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEPVRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WNT7A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Wnt-7a Protein (NBP1-86071PEP)
Publications
Read Publications using
NBP1-86071 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22232518)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Wnt-7a Antibody

  • protein Wnt-7a
  • proto-oncogene Wnt7a protein
  • wingless-type MMTV integration site family, member 7A
  • Wnt7a
  • Wnt-7a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

645-WN/CF
Species: Hu, Mu
AF475
Species: Mu
Applications: WB, IHC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
423-F8/CF
Species: Hu, Mu
3008-WN/CF
Species: Hu
NBP2-46367
Species: Hu
Applications: WB, IHC
NBP2-15163
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31406
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00002019-M04
Species: Hu
Applications: WB, ELISA, IHC-P
AF1620
Species: Mu
Applications: WB, IHC
AF4109
Species: Hu
Applications: WB, IHC
AF1617
Species: Hu
Applications: WB
3900-WN/CF
Species: Mu
NBP1-86071
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Wnt-7a Antibody (NBP1-86071)(4)

Reviews for Wnt-7a Antibody (NBP1-86071) (0)

There are no reviews for Wnt-7a Antibody (NBP1-86071). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Wnt-7a Antibody (NBP1-86071). (Showing 1 - 1 of 1 FAQs).

  1. Do you have evidence or know that your Wnt7A antibody is specific for Wnt7A or whether it actually does detect Wnt7B as well? I'm looking for a Wnt7A-specific antibody and so far have had no luck.
    • The immunogen sequence for NBP1-86071 is 76% homologous to the human Wnt7B sequence. Due to this homology, we predict that there might be some cross reaction. Unfortunately, due to the similarity in the sequences, we do not currently have a product that is made specifically to Wnt7A that we know, with certainty, will not cross react with Wnt7B. If you could find an antibody made to the specific 1-25aa region of Wnt7A, there might be enough difference as to ensure there would be little to no cross reaction, but we unfortunately do not currently carry any antibodies to this specific region.

Secondary Antibodies

 

Isotype Controls

Additional Wnt-7a Products

Bioinformatics Tool for Wnt-7a Antibody (NBP1-86071)

Discover related pathways, diseases and genes to Wnt-7a Antibody (NBP1-86071). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Wnt-7a Antibody (NBP1-86071)

Discover more about diseases related to Wnt-7a Antibody (NBP1-86071).
 

Pathways for Wnt-7a Antibody (NBP1-86071)

View related products by pathway.

PTMs for Wnt-7a Antibody (NBP1-86071)

Learn more about PTMs related to Wnt-7a Antibody (NBP1-86071).
 

Research Areas for Wnt-7a Antibody (NBP1-86071)

Find related products by research area.

Blogs on Wnt-7a

There are no specific blogs for Wnt-7a, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Wnt-7a Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WNT7A
Entrez