Wnt-2b Antibody


Western Blot: Wnt-2b Antibody [NBP1-53120] - Jurkat Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide Primary Antibody Concentration: 1. 25 ug/ml Peptide Concentration: 4.0 ug/ml lysate Quantity: ...read more
Immunohistochemistry-Paraffin: Wnt-2b Antibody [NBP1-53120] - Human Testis.
Western Blot: Wnt-2b Antibody [NBP1-53120] - Jurkat tissue lysate at a concentration of 1.25ug/ml.
Immunohistochemistry-Paraffin: Wnt-2b Antibody [NBP1-53120] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Wnt-2b Antibody Summary

Synthetic peptides corresponding to WNT2B (wingless-type MMTV integration site family, member 2B) The peptide sequence was selected from the middle region of WNT2B. Peptide sequence LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against WNT2B and was validated on Western Blot and immunohistochemistry-P

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Wnt-2b Antibody

  • Protein Wnt-13
  • protein Wnt-2b
  • wingless-type MMTV integration site family, member 2B
  • Wnt-13
  • WNT13XWNT2, Xenopus, homolog of
  • Wnt2b
  • Wnt-2b
  • XWNT2
  • XWNT2wingless-type MMTV integration site family, member 13


WNT2B is a member of the wingless-type MMTV integration site (WNT) family of highly conserved, secreted signaling factors. WNT family members function in a variety of developmental processes including regulation of cell growth and differentiation and are characterized by a WNT-core domain. This gene may play a role in human development as well as human carcinogenesis. This gene produces two alternative transcript variants.This gene encodes a member of the wingless-type MMTV integration site (WNT) family of highly conserved, secreted signaling factors. WNT family members function in a variety of developmental processes including regulation of cell growth and differentiation and are characterized by a WNT-core domain. This gene may play a role in human development as well as human carcinogenesis. This gene produces two alternative transcript variants.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB
Species: Mu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Wnt-2b Antibody (NBP1-53120) (0)

There are no publications for Wnt-2b Antibody (NBP1-53120).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Wnt-2b Antibody (NBP1-53120) (0)

There are no reviews for Wnt-2b Antibody (NBP1-53120). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Wnt-2b Antibody (NBP1-53120) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Wnt-2b Products

Bioinformatics Tool for Wnt-2b Antibody (NBP1-53120)

Discover related pathways, diseases and genes to Wnt-2b Antibody (NBP1-53120). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Wnt-2b Antibody (NBP1-53120)

Discover more about diseases related to Wnt-2b Antibody (NBP1-53120).

Pathways for Wnt-2b Antibody (NBP1-53120)

View related products by pathway.

PTMs for Wnt-2b Antibody (NBP1-53120)

Learn more about PTMs related to Wnt-2b Antibody (NBP1-53120).

Research Areas for Wnt-2b Antibody (NBP1-53120)

Find related products by research area.

Blogs on Wnt-2b

There are no specific blogs for Wnt-2b, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Wnt-2b Antibody and receive a gift card or discount.


Gene Symbol WNT2B