Wnt-3a Antibody - BSA Free

Western Blot: Wnt-3a Antibody [NBP1-74183] - Sample Tissue: Mouse Heart, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane, Gel Concentration: 0.12%

Immunohistochemistry-Paraffin: Wnt-3a Antibody [NBP1-74183] - Human placenta tissue at an antibody concentration of Dilution: 1:500.

Western Blot: Wnt-3a Antibody [NBP1-74183] - Titration: 1 ug/ml Positive Control: Mouse Heart lysate.

Western Blot: Wnt-3a Antibody [NBP1-74183] - Mouse Heart. Lane A: Primary Antibody. Lane B: Primary Antibody + Blocking Peptide.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Wnt-3a Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to the C terminal of Wnt3a. Immunizing peptide sequence IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WNT3A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 2.5 ug/ml
  • Immunohistochemistry-Paraffin 2.5 ug/ml
  • Western Blot 1.0 ug/ml
• Theoretical MW: 38 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Wnt-3a Antibody - BSA Free

• MGC119418
• MGC119419
• MGC119420
• protein Wnt-3a
• wingless-type MMTV integration site family, member 3A
• Wnt3a
• Wnt-3a

Background

Wnt3a is a ligand for members of the frizzled family of seven transmembrane receptors. Wnt-3 and Wnt-3a play distinct roles in cell-cell signaling during morphogenesis of the developing neural tube.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Wnt-3a Antibody (NBP1-74183)(4)

Publications using NBP1-74183

• Song K, Hu J, Yang M et Al. Pulsed electromagnetic fields potentiate bone marrow mesenchymal stem cell chondrogenesis by regulating the Wnt/?-catenin signaling pathway J Transl Med 2024-08-07 [PMID: 39107784]
• Chaves-P�rez A, Santos-de-Frutos K, de la Rosa S et al. Transit-amplifying cells control R-spondins in the mouse crypt to modulate intestinal stem cell proliferation Journal of Experimental Medicine 2022-11-07 [PMID: 36098959] (Immunohistochemistry, Immunohistochemistry-Paraffin)
• Karata? A, �merciko?lu Z, �z B et al. Wnt signaling pathway activities may be altered in primary Sjogren�s syndrome TURKISH JOURNAL OF MEDICAL SCIENCES 2021-08-30 [PMID: 34058801] (Immunohistochemistry, Immunohistochemistry-Paraffin)
• Duong TB Effects of 2,4-Di-Tert-Butylphenol on Osteogenic and Myogenic Differentiation of Human Induced Pluripotent Stem Cells Thesis 2022-01-01 (WB, Human)

Bioinformatics

• Gene Symbol: WNT3A
• Uniprot:
  • P27467()