LEF1 Antibody (3H5)

Images

 
Western Blot: LEF1 Antibody (3H5) [H00051176-M01] - LEF1 monoclonal antibody (M01), clone 3H5 Analysis of LEF1 expression in MES-SA/Dx5.
Western Blot: LEF1 Antibody (3H5) [H00051176-M01] - Analysis of LEF1 over-expressed 293 cell line, cotransfected with LEF1 Validated Chimera RNAi ( Cat # H00051176-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Western Blot: LEF1 Antibody (3H5) [H00051176-M01] - LEF1 monoclonal antibody (M01), clone 3H5. Analysis of LEF1 expression in HL-60.
Western Blot: LEF1 Antibody (3H5) [H00051176-M01] - Analysis of LEF1 expression in transfected 293T cell line by LEF1 monoclonal antibody (M01), clone 3H5.Lane 1: LEF1 transfected lysate(44.2 KDa).Lane 2: ...read more
Sandwich ELISA: LEF1 Antibody (3H5) [H00051176-M01] - Detection limit for recombinant GST tagged LEF1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, PLA, RNAi, S-ELISA
Clone
3H5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

LEF1 Antibody (3H5) Summary

Immunogen
LEF1 (AAH50632, 1 a.a. ~ 399 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESASGTGPRMTAAYI
Specificity
LEF1 - lymphoid enhancer-binding factor 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LEF1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Proximity Ligation Assay
  • RNA Inhibition
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for RNAi validation and ELISA.
Publications
Read Publications using H00051176-M01.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LEF1 Antibody (3H5)

  • DKFZp586H0919
  • FLJ46390
  • LEF1
  • LEF-1
  • lymphoid enhancer-binding factor 1
  • T cell-specific transcription factor 1-alpha
  • TCF10
  • TCF1ALPHA
  • TCF1-alpha
  • TCF7L3

Background

Lymphoid enhancer-binding factor-1 (LEF1) is a 48-kD nuclear protein that is expressed in pre-B and T cells. It binds to a functionally important site in the T-cell receptor-alpha (TCRA; MIM 186880) enhancer and confers maximal enhancer activity. LEF1 belongs to a family of regulatory proteins that share homology with high mobility group protein-1 (HMG1; MIM 163905).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-89679
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF5596
Species: Hu
Applications: WB, IHC, ICC
H00006934-M06
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, PAGE
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF6116
Species: Hu
Applications: WB, ICC
H00006925-M03
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP2-24695
Species: Hu
Applications: WB, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB600-302
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-51575
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF3287
Species: Hu, Mu, Rt
Applications: WB
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7650
Species: Mu
Applications: WB, IHC
H00051176-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, PLA, RNAi, S-ELISA

Publications for LEF1 Antibody (H00051176-M01)(3)

Reviews for LEF1 Antibody (H00051176-M01) (0)

There are no reviews for LEF1 Antibody (H00051176-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LEF1 Antibody (H00051176-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LEF1 Products

Bioinformatics Tool for LEF1 Antibody (H00051176-M01)

Discover related pathways, diseases and genes to LEF1 Antibody (H00051176-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LEF1 Antibody (H00051176-M01)

Discover more about diseases related to LEF1 Antibody (H00051176-M01).
 

Pathways for LEF1 Antibody (H00051176-M01)

View related products by pathway.

PTMs for LEF1 Antibody (H00051176-M01)

Learn more about PTMs related to LEF1 Antibody (H00051176-M01).
 

Research Areas for LEF1 Antibody (H00051176-M01)

Find related products by research area.

Blogs on LEF1.

The role of Wnts in neuroinflammation
By Michalina Hanzel, PhDThe multifaceted roles of the Wnt family of glycoproteins have been extensively characterized throughout embryonic development and adult homeostasis. The highly conserved, cell- and tissue- s...  Read full blog post.

Beta Catenin in Cell Adhesion and T-cell Signaling
Beta Catenin is a cytosolic, 88 kDa intracellular protein that tightly associates with cell surface cadherin glycoproteins. It is one member of the catenin family that includes alpha Catenin, beta Catenin, and gamma Catenin. Colocalization studies usi...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LEF1 Antibody (3H5) and receive a gift card or discount.

Bioinformatics

Gene Symbol LEF1
Entrez
OMIM
Uniprot