Wnt-3a Antibody

Images

 
Western Blot: Wnt-3a Antibody [NBP1-74183] - Sample Tissue: Mouse Heart, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, ...read more
Immunohistochemistry-Paraffin: Wnt-3a Antibody [NBP1-74183] - Human placenta tissue at an antibody concentration of Dilution: 1:500.
Western Blot: Wnt-3a Antibody [NBP1-74183] - Titration: 1 ug/ml Positive Control: Mouse Heart lysate.
Western Blot: Wnt-3a Antibody [NBP1-74183] - Mouse Heart. Lane A: Primary Antibody. Lane B: Primary Antibody + Blocking Peptide.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Wnt-3a Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of Wnt3a. Immunizing peptide sequence IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WNT3A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 2.5 ug/ml
  • Immunohistochemistry-Paraffin 2.5 ug/ml
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Wnt3a and was validated on Western blot.
Theoretical MW
38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Wnt-3a Protein (NBP1-74183PEP)
Publications
Read Publication using
NBP1-74183 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Wnt-3a Antibody

  • MGC119418
  • MGC119419
  • MGC119420
  • protein Wnt-3a
  • wingless-type MMTV integration site family, member 3A
  • Wnt3a
  • Wnt-3a

Background

Wnt3a is a ligand for members of the frizzled family of seven transmembrane receptors. Wnt-3 and Wnt-3a play distinct roles in cell-cell signaling during morphogenesis of the developing neural tube.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46367
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-54467
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
5439-DK/CF
Species: Hu
Applications: BA
NBP1-89679
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
645-WN/CF
Species: Hu, Mu
Applications: BA
NBP1-51575
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
5036-WN/CF
Species: Hu
Applications: BA, BA
314-BP/CF
Species: Hu
Applications: BA, BA
H00051176-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, KD, PLA, S-ELISA, WB
355-BM/CF
Species: Hu, Mu, Rt
Applications: BA
AF1505
Species: Hu
Applications: CyTOF-ready, Flow, WB
AF6646
Species: Hu
Applications: WB
AF3287
Species: Hu, Mu, Rt
Applications: WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-54467
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
423-F8
Species: Hu, Mu
Applications: BA
NBP1-47470
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
1845-SH/CF
Species: Hu
Applications: BA

Publications for Wnt-3a Antibody (NBP1-74183)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publication 1 - 1 of 1.
Publication using NBP1-74183 Applications Species
Duong TB Effects of 2,4-Di-Tert-Butylphenol on Osteogenic and Myogenic Differentiation of Human Induced Pluripotent Stem Cells Thesis Jan 1 2022 (WB, Human) WB Human

Reviews for Wnt-3a Antibody (NBP1-74183) (0)

There are no reviews for Wnt-3a Antibody (NBP1-74183). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Wnt-3a Antibody (NBP1-74183) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Wnt-3a Products

Bioinformatics Tool for Wnt-3a Antibody (NBP1-74183)

Discover related pathways, diseases and genes to Wnt-3a Antibody (NBP1-74183). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Wnt-3a Antibody (NBP1-74183)

Discover more about diseases related to Wnt-3a Antibody (NBP1-74183).
 

Pathways for Wnt-3a Antibody (NBP1-74183)

View related products by pathway.

PTMs for Wnt-3a Antibody (NBP1-74183)

Learn more about PTMs related to Wnt-3a Antibody (NBP1-74183).
 

Research Areas for Wnt-3a Antibody (NBP1-74183)

Find related products by research area.

Blogs on Wnt-3a

There are no specific blogs for Wnt-3a, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Wnt-3a Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WNT3A
Uniprot