WNK3 Antibody

Western Blot: WNK3 Antibody [NBP2-93100] - Analysis of HAP1, using WNK3 antibody at 1:540 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 90s.

Immunocytochemistry/Immunofluorescence: WNK3 Antibody [NBP2-93100] - Immunofluorescence analysis of U2OS cells using WNK3 Rabbit pAb (NBP2-93100) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: WNK3 Antibody [NBP2-93100] - Immunofluorescence analysis of NIH/3T3 cells using WNK3 Rabbit pAb (NBP2-93100) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: WNK3 Antibody [NBP2-93100] - Immunofluorescence analysis of PC-12 cells using WNK3 Rabbit pAb (NBP2-93100) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

WNK3 Antibody Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 500-600 of human WNK3 (NP_065973.2). AGCLEERRDSQCKSMGNVFPQPQNTTLPLAPAQQTGAECEETEVDQHVRQQLLQRKPQQHCSSVTGDNLSEAGAASVIHSDTSSQPSVAYSSNQTMGSQMV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WNK3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 1:50 - 1:200
  • Western Blot 1:100 - 1:500

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for WNK3 Antibody

• EC 2.7.11
• FLJ30437
• KIAA1566FLJ42662
• PRKWNK3lysine deficient 3
• WNK lysine deficient protein kinase 3

Background

Members of the 'with no lysine' (WNK) kinase family, such as WNK3, are serine-threonine protein kinases thatlack the almost invariant catalytic lysine in subdomain II, which is important for binding ATP in the catalytic site.Instead, these kinases have a conserved lysine in subdomain I that is thought to provide this function (Holden et al.,2004 (PubMed 15194194)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: WNK3