KCNJ1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: KCNJ1 Antibody [NBP1-82874] - Staining in human kidney and lymph node tissues using anti-KCNJ1 antibody. Corresponding KCNJ1 RNA-seq data are presented for ...read more
Immunohistochemistry-Paraffin: KCNJ1 Antibody [NBP1-82874] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: KCNJ1 Antibody [NBP1-82874] - Staining of human kidney shows high expression.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

KCNJ1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: STSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLYNEKDVRARMKRGYDNPNFILSEVNETD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNJ1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
Use in ICC/IF, reported in scientific literature (PMID:33779313) IHC reported in scientific literature (PMID: 29767556). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
KCNJ1 Protein (NBP1-82874PEP)
Publications
Read Publications using
NBP1-82874 in the following applications:

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 29767556). Mouse reactivity reported in scientific literature (PMID: 33779313).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KCNJ1 Antibody

  • ATP-regulated potassium channel ROM-K
  • ATP-sensitive inward rectifier potassium channel 1
  • inwardly rectifying K+ channel
  • KIR1.1
  • potassium inwardly-rectifying channel, subfamily J, member 1
  • ROMK1inwardly rectifying subfamily J member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58906
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
MAB1225
Species: Hu
Applications: Block, CyTOF-reported, Flow
NBP2-12900
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, Simple Western, WB
NBP1-44270
Species: Mu, Rt
Applications: EM, ICC/IF, IHC, IHC-P, WB
NBP1-80993
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-01702
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB600-284
Species: Hu, Mu, Rt
Applications: EM, ICC/IF (-), IHC, IHC-Fr, IHC-P, IP, WB
H00001188-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-20149
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
NBP2-76944
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-59320
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
AF2849
Species: Mu, Rt
Applications: WB
NBP1-82016
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-74575
Species: Hu
Applications: ICC/IF, IHC, PEP-ELISA, WB
NBL1-12174
Species: Hu
Applications: WB

Publications for KCNJ1 Antibody (NBP1-82874)(3)

Reviews for KCNJ1 Antibody (NBP1-82874) (0)

There are no reviews for KCNJ1 Antibody (NBP1-82874). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KCNJ1 Antibody (NBP1-82874) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KCNJ1 Products

Bioinformatics Tool for KCNJ1 Antibody (NBP1-82874)

Discover related pathways, diseases and genes to KCNJ1 Antibody (NBP1-82874). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCNJ1 Antibody (NBP1-82874)

Discover more about diseases related to KCNJ1 Antibody (NBP1-82874).
 

Pathways for KCNJ1 Antibody (NBP1-82874)

View related products by pathway.

PTMs for KCNJ1 Antibody (NBP1-82874)

Learn more about PTMs related to KCNJ1 Antibody (NBP1-82874).
 

Research Areas for KCNJ1 Antibody (NBP1-82874)

Find related products by research area.

Blogs on KCNJ1

There are no specific blogs for KCNJ1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KCNJ1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNJ1
Entrez
Uniprot