KCNJ1 Antibody

Images

 
Immunohistochemistry-Paraffin: KCNJ1 Antibody [NBP1-82874] - Staining of human kidney shows distinct membranous positivity in distal renal tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KCNJ1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:STSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLYNEKDVRARMKRGYDNPNFILSEVNETD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNJ1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
KCNJ1 Protein (NBP1-82874PEP)
Publications
Read Publication using NBP1-82874.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23940364)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KCNJ1 Antibody

  • ATP-regulated potassium channel ROM-K
  • ATP-sensitive inward rectifier potassium channel 1
  • inwardly rectifying K+ channel
  • KIR1.1
  • potassium inwardly-rectifying channel, subfamily J, member 1
  • ROMK1inwardly rectifying subfamily J member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58906
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB12251
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-12900
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86376
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57622
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01702
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-284
Species: Hu, Mu, Rt
Applications: ICC/IF (-), WB, EM, IHC, IHC-Fr, IHC-P
H00001188-P01
Species: Hu
NBP1-20149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-00206
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-82016
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74575
Species: Hu
Applications: WB, PEP-ELISA
NBP1-87710
Species: Hu
Applications: WB, IHC, IHC-P

Publications for KCNJ1 Antibody (NBP1-82874)(1)

Reviews for KCNJ1 Antibody (NBP1-82874) (0)

There are no reviews for KCNJ1 Antibody (NBP1-82874). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for KCNJ1 Antibody (NBP1-82874) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KCNJ1 Products

Bioinformatics Tool for KCNJ1 Antibody (NBP1-82874)

Discover related pathways, diseases and genes to KCNJ1 Antibody (NBP1-82874). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCNJ1 Antibody (NBP1-82874)

Discover more about diseases related to KCNJ1 Antibody (NBP1-82874).
 

Pathways for KCNJ1 Antibody (NBP1-82874)

View related products by pathway.

PTMs for KCNJ1 Antibody (NBP1-82874)

Learn more about PTMs related to KCNJ1 Antibody (NBP1-82874).

Blogs on KCNJ1

There are no specific blogs for KCNJ1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KCNJ1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNJ1
Entrez
Uniprot