Orthogonal Strategies: Immunohistochemistry-Paraffin: KCNJ1 Antibody [NBP1-82874] -Analysis in human kidney and pancreas tissues using NBP1-82874 antibody. Corresponding KCNJ1 RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: KCNJ1 Antibody [NBP1-82874] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: KCNJ1 Antibody [NBP1-82874] -Staining of human lymph node shows no positivity in non-germinal center cells as expected.
Immunohistochemistry-Paraffin: KCNJ1 Antibody [NBP1-82874] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: KCNJ1 Antibody [NBP1-82874] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Novus Biologicals Rabbit KCNJ1 Antibody - BSA Free (NBP1-82874) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-KCNJ1 Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: STSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLYNEKDVRARMKRGYDNPNFILSEVNETD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNJ1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Immunocytochemistry/ Immunofluorescence Reported in scientific literature (PMID:33779313)
Immunohistochemistry 1:50 - 1:200
Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
45 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
potassium inwardly-rectifying channel, subfamily J, member 1
ROMK1inwardly rectifying subfamily J member 1
Background
FUNCTION: In the kidney, probably plays a major role in potassium homeostasis. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. This channel is activated by internal ATP and can be blocked by external barium.; Tissue specificity: In the kidney and pancreatic islets. Lower levels in skeletal muscle, pancreas, spleen, brain, heart and liver.; Subcellular location: Membrane, Multi-pass membrane protein.; Involvement in disease: Defects in KCNJ1 are the cause of Bartter syndrome type 2 (BS2) also termed hyperprostanglandin E syndrome 2. BS refers to a group of autosomal recessive disorders characterized by impaired salt reabsorption in the thick ascending loop of Henle with pronounced salt wasting, hypokalemic metabolic alkalosis, and varying degrees of hypercalciuria. BS2 is a life-threatening condition beginning in utero, with marked fetal polyuria that leads to polyhydramnios and premature delivery. Another hallmark of BS2 is a marked hypercalciuria and, as a secondary consequence, the development of nephrocalcinosis and osteopenia.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our KCNJ1 Antibody - BSA Free and receive a gift card or discount.