Orthogonal Strategies: Immunohistochemistry-Paraffin: KCNJ1 Antibody [NBP1-82874] - Staining in human kidney and lymph node tissues using anti-KCNJ1 antibody. Corresponding KCNJ1 RNA-seq data are presented for ...read more
Immunohistochemistry-Paraffin: KCNJ1 Antibody [NBP1-82874] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: KCNJ1 Antibody [NBP1-82874] - Staining of human kidney shows high expression.
This antibody was developed against Recombinant Protein corresponding to amino acids: STSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLYNEKDVRARMKRGYDNPNFILSEVNETD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNJ1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Use in ICC/IF, reported in scientific literature (PMID:33779313) IHC reported in scientific literature (PMID: 29767556). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
45 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
potassium inwardly-rectifying channel, subfamily J, member 1
ROMK1inwardly rectifying subfamily J member 1
Background
FUNCTION: In the kidney, probably plays a major role in potassium homeostasis. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. This channel is activated by internal ATP and can be blocked by external barium.; Tissue specificity: In the kidney and pancreatic islets. Lower levels in skeletal muscle, pancreas, spleen, brain, heart and liver.; Subcellular location: Membrane, Multi-pass membrane protein.; Involvement in disease: Defects in KCNJ1 are the cause of Bartter syndrome type 2 (BS2) also termed hyperprostanglandin E syndrome 2. BS refers to a group of autosomal recessive disorders characterized by impaired salt reabsorption in the thick ascending loop of Henle with pronounced salt wasting, hypokalemic metabolic alkalosis, and varying degrees of hypercalciuria. BS2 is a life-threatening condition beginning in utero, with marked fetal polyuria that leads to polyhydramnios and premature delivery. Another hallmark of BS2 is a marked hypercalciuria and, as a secondary consequence, the development of nephrocalcinosis and osteopenia.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Bioinformatics Tool for KCNJ1 Antibody (NBP1-82874)
Discover related pathways, diseases and genes to KCNJ1 Antibody (NBP1-82874). Need help?
Read the Bioinformatics Tool Guide for instructions on using this tool.
Diseases for KCNJ1 Antibody (NBP1-82874)
Discover more about diseases related to KCNJ1 Antibody (NBP1-82874).
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our KCNJ1 Antibody and receive a gift card or discount.