WNK2 Antibody

Immunohistochemistry-Paraffin: WNK2 Antibody [NBP2-33875] - Staining in human fallopian tube and liver tissues using anti-WNK2 antibody. Corresponding WNK2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: WNK2 Antibody [NBP2-33875] - Staining of human cerebral cortex, colon, fallopian tube and liver using Anti-WNK2 antibody NBP2-33875 (A) shows similar protein distribution across tissues to independent antibody NBP2-33876 (B).

Immunocytochemistry/Immunofluorescence: WNK2 Antibody [NBP2-33875] - Immunofluorescent staining of human cell line Hep G2 shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: WNK2 Antibody [NBP2-33875] - Staining of human fallopian tube using Anti-WNK2 antibody NBP2-33875.

Immunohistochemistry-Paraffin: WNK2 Antibody [NBP2-33875] - Staining of human colon.

Immunohistochemistry-Paraffin: WNK2 Antibody [NBP2-33875] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: WNK2 Antibody [NBP2-33875] - Staining of human liver using Anti-WNK2 antibody NBP2-33875.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

WNK2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KHLKEISELQSQQKQEIEALYRRLGKPLPPNVGFFHTAPPTGRRRKTSKSKLKAGKLLNPLVRQLKVVASST
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WNK2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  WNK2 Protein (NBP2-33875PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for WNK2 Antibody

• EC 2.7.11
• EC 2.7.11.1
• PRK
• PRKWNK2
• Protein kinase with no lysine 2
• SDCCAG43
• serine/threonine-protein kinase WNK2
• Serologically defined colon cancer antigen 43lysine deficient 2
• WNK lysine deficient protein kinase 2

Background

WNK2 is encoded by this gene is a cytoplasmic serine-threonine kinase that contains cysteine in place of the lysine found at the conserved ATP-binding location in subdomain II of protein kinases. Since this protein does have kinase activity, it is possible that another lysine in the kinase subdomain I can substitute for the missing conserved lysine.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for WNK2 Antibody (NBP2-33875)(1)

Publication using NBP2-33875

• Rehman T, Karp PH, Thurman AL et al. WNK Inhibition Increases Surface Liquid pH and Host Defense in Cystic Fibrosis Airway Epithelia American journal of respiratory cell and molecular biology 2022-07-18 [PMID: 35849656] (ICC/IF)

Bioinformatics

• Gene Symbol: WNK2
• Uniprot:
  • Q9Y3S1(Human)