FAM120C Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FAM120C Antibody [NBP2-13977] - Staining of human cell line HEK 293 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: FAM120C Antibody [NBP2-13977] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM120C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KGHGKEQTGRGSKGHKKGNKQGSSDGVSKSLELHQGRSRSQVNGNSGALI KEEKSDHRLPAPSQCALSRDSNECNNGNRYLPM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM120C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM120C Protein (NBP2-13977PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM120C Antibody

  • family with sequence similarity 120C
  • ORF34

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-93313
Species: Hu
Applications: WB, ChIP, IHC-P, IP, PLA
NBP1-03340
Species: Hu
Applications: WB, IP
NBP1-86715
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
MAB8396
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBL1-11228
Species: Hu
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB10541
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
NBP1-92435
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88446
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32083
Species: Hu
Applications: WB, ICC/IF
NB100-509
Species: Hu, Mu
Applications: WB, IP

Publications for FAM120C Antibody (NBP2-13977) (0)

There are no publications for FAM120C Antibody (NBP2-13977).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM120C Antibody (NBP2-13977) (0)

There are no reviews for FAM120C Antibody (NBP2-13977). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FAM120C Antibody (NBP2-13977) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM120C Products

FAM120C NBP2-13977

Bioinformatics Tool for FAM120C Antibody (NBP2-13977)

Discover related pathways, diseases and genes to FAM120C Antibody (NBP2-13977). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM120C Antibody (NBP2-13977)

Discover more about diseases related to FAM120C Antibody (NBP2-13977).
 

Pathways for FAM120C Antibody (NBP2-13977)

View related products by pathway.

Blogs on FAM120C

There are no specific blogs for FAM120C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM120C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM120C