KCC3/SLC12A6 Antibody

Immunocytochemistry/Immunofluorescence: KCC3/SLC12A6 Antibody [NBP1-89282] - Staining of human cell line A-431 shows localization to cytosol & vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: KCC3/SLC12A6 Antibody [NBP1-89282] - Staining of human Lymph node shows moderate membranous and cytoplasmic positivity in germinal and non-germinal center cells.

Immunohistochemistry-Paraffin: KCC3/SLC12A6 Antibody [NBP1-89282] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: KCC3/SLC12A6 Antibody [NBP1-89282] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: KCC3/SLC12A6 Antibody [NBP1-89282] - Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

KCC3/SLC12A6 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RVRFSSRESVPETSRSEPMSEMSGATTSLATVALDPPSDRTSHPQDVIEDLSQNSITGEHSQLLDDGHKKARNAYLNNSNYEEGDE
• Predicted Species: Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC12A6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  KCC3/SLC12A6 Protein (NBP1-89282PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25110711).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for KCC3/SLC12A6 Antibody

• ACCPN
• agenesis of corpus callosum and peripheral neuropathy (Andermann syndrome)
• DKFZp434D2135
• EC 1.2.4.1
• EC 6.1.1.3
• Electroneutral potassium-chloride cotransporter 3
• KCC3
• KCC3A
• KCC3B
• KCC3potassium chloride cotransporter 3
• K-Cl cotransporter 3
• potassium chloride cotransporter KCC3a-S3
• potassium-chloride transporter-3a
• potassium-chloride transporter-3b
• SLC12A6
• solute carrier family 12 (potassium/chloride transporters), member 6
• solute carrier family 12 member 6

Background

SLC12A6 is a member of the K-Cl cotransporter (KCC) family. K-Cl cotransporters are integral membrane proteins that lower intracellular chloride concentrations below the electrochemical equilibrium potential. The proteins encoded by this gene are activated by cell swelling induced by hypotonic conditions. Alternate splicing results in multiple transcript variants encoding different isoforms. Mutations in this gene are associated with agenesis of the corpus callosum with peripheral neuropathy. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KCC3/SLC12A6 Antibody (NBP1-89282)(1)

Publication using NBP1-89282

• Shiozaki A, Takemoto K, Ichikawa D et al. The K-Cl Cotransporter KCC3 as an Independent Prognostic Factor in Human Esophageal Squamous Cell Carcinoma. Biomed Res Int 2014-01-01 [PMID: 25110711] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: SLC12A6