KCC3/SLC12A6 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: KCC3/SLC12A6 Antibody [NBP1-89282] - Staining of human cell line A-431 shows localization to cytosol & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: KCC3/SLC12A6 Antibody [NBP1-89282] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: KCC3/SLC12A6 Antibody [NBP1-89282] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine pancreas.
Immunohistochemistry-Paraffin: KCC3/SLC12A6 Antibody [NBP1-89282] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: KCC3/SLC12A6 Antibody [NBP1-89282] - Staining of human prostate shows weak to moderate membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: KCC3/SLC12A6 Antibody [NBP1-89282] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KCC3/SLC12A6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RVRFSSRESVPETSRSEPMSEMSGATTSLATVALDPPSDRTSHPQDVIEDLSQNSITGEHSQLLDDGHKKARNAYLNNSNYEEGDE
Specificity
Specificity of human KCC3/SLC12A6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC12A6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KCC3/SLC12A6 Protein (NBP1-89282PEP)
Publications
Read Publication using
NBP1-89282 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25110711).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KCC3/SLC12A6 Antibody

  • ACCPN
  • agenesis of corpus callosum and peripheral neuropathy (Andermann syndrome)
  • DKFZp434D2135
  • EC 1.2.4.1
  • EC 6.1.1.3
  • Electroneutral potassium-chloride cotransporter 3
  • KCC3
  • KCC3A
  • KCC3B
  • KCC3potassium chloride cotransporter 3
  • K-Cl cotransporter 3
  • potassium chloride cotransporter KCC3a-S3
  • potassium-chloride transporter-3a
  • potassium-chloride transporter-3b
  • SLC12A6
  • solute carrier family 12 (potassium/chloride transporters), member 6
  • solute carrier family 12 member 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85133
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-06043
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
MAB8369
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-75623
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
NBP2-89114
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-44270
Species: Mu, Rt
Applications: WB, EM, ICC/IF, IHC, IHC-P
NBP1-80993
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-146
Species: Hu, Mu, Rt, Po, Bv, Ca, Dr, Gp, Pm, Rb, Sh, Xp, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-67691
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-48021
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP3-05584
Species: Mu, Rt
Applications: WB
NBP1-90300
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-76990
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-14843
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00001181-M01
Species: Hu
Applications: WB, ELISA, RNAi, S-ELISA
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89282
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for KCC3/SLC12A6 Antibody (NBP1-89282)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for KCC3/SLC12A6 Antibody (NBP1-89282) (0)

There are no reviews for KCC3/SLC12A6 Antibody (NBP1-89282). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KCC3/SLC12A6 Antibody (NBP1-89282) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional KCC3/SLC12A6 Products

Bioinformatics Tool for KCC3/SLC12A6 Antibody (NBP1-89282)

Discover related pathways, diseases and genes to KCC3/SLC12A6 Antibody (NBP1-89282). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCC3/SLC12A6 Antibody (NBP1-89282)

Discover more about diseases related to KCC3/SLC12A6 Antibody (NBP1-89282).
 

Pathways for KCC3/SLC12A6 Antibody (NBP1-89282)

View related products by pathway.

PTMs for KCC3/SLC12A6 Antibody (NBP1-89282)

Learn more about PTMs related to KCC3/SLC12A6 Antibody (NBP1-89282).

Blogs on KCC3/SLC12A6

There are no specific blogs for KCC3/SLC12A6, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KCC3/SLC12A6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC12A6