Wee1 Antibody

Images

 
Western Blot: Wee1 Antibody [NBP2-56925] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: Wee1 Antibody [NBP2-56925] - Staining of human cell line RH-30 shows localization to nucleoli.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Wee1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LLKVMIHPDPERRPSAMALVKHSVLLSASRKSAEQLRIELNAEKFKNSLLQKELKKAQMAKAAAEERALFTDRMATRSTTQ
Specificity
Specificity of human Wee1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WEE1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Wee1 Antibody

  • DKFZp686I18166
  • EC 2.7.10.2
  • FLJ16446
  • WEE1 homolog (S. pombe)
  • wee1+ (S. pombe) homolog
  • WEE1+ homolog
  • Wee1A kinase
  • WEE1A
  • WEE1hu
  • wee1-like protein kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33687
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-44687
Species: Hu, Mu
Applications: Flow, IHC-P, IF
NB100-1768
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-02275
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-81021
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-46085
Species: Hu
Applications: WB, IHC
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA
NB100-74502
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88224
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56546
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
NB100-104
Species: Hu, Mu, Rt, Kg
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP

Publications for Wee1 Antibody (NBP2-56925) (0)

There are no publications for Wee1 Antibody (NBP2-56925).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Wee1 Antibody (NBP2-56925) (0)

There are no reviews for Wee1 Antibody (NBP2-56925). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Wee1 Antibody (NBP2-56925) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Wee1 Products

Bioinformatics Tool for Wee1 Antibody (NBP2-56925)

Discover related pathways, diseases and genes to Wee1 Antibody (NBP2-56925). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Wee1 Antibody (NBP2-56925)

Discover more about diseases related to Wee1 Antibody (NBP2-56925).
 

Pathways for Wee1 Antibody (NBP2-56925)

View related products by pathway.

PTMs for Wee1 Antibody (NBP2-56925)

Learn more about PTMs related to Wee1 Antibody (NBP2-56925).
 

Research Areas for Wee1 Antibody (NBP2-56925)

Find related products by research area.

Blogs on Wee1.

Funny Protein Names Infographic
This is not a joke, these proteins with funny names actually do exist. View our list of six proteins with funny and unusual names including: Bambi, Yippee-like 3, Wee1, SPAM1, SPOCK1 and Bagpipe homeobox protein homolog 1. Learn more about their fu...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Wee1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WEE1