WAPL Antibody - BSA Free

Immunohistochemistry-Paraffin: WAPL Antibody [NBP1-92579] - Staining of human testis.

Immunohistochemistry-Paraffin: WAPL Antibody [NBP1-92579] - Staining of human colon, lymph node, skin and testis using Anti-WAPL antibody NBP1-92579 (A) shows similar protein distribution across tissues to independent antibody NBP1-92578 (B).

Immunohistochemistry-Paraffin: WAPL Antibody [NBP1-92579] - Staining of human colon.

Immunohistochemistry-Paraffin: WAPL Antibody [NBP1-92579] - Staining of human skin.

Immunohistochemistry-Paraffin: WAPL Antibody [NBP1-92579] - Staining of human lymph node.

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

WAPL Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TTQHDKSGEWQETSGEIQWVSTEKTDGTEEKHKKEEEDEELDLNKALQHAGKHMEDCIVASYTALLLGCLCQESPINVTTVREYLPEGDFSIM
• Predicted Species: Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WAPL
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  WAPL Protein (NBP1-92579PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for WAPL Antibody - BSA Free

• FOEKIAA0261friend of EBNA2 (Epstein-Barr virus nuclear protein 2)
• Friend of EBNA2 protein
• WAPLwings apart-like protein homolog
• wings apart-like homolog (Drosophila)

Background

The hWAPL mRNA was predominantly expressed in uterine cervical cancer, with weak expression in all other normal and tumor tissues examined. hWAPL expression in benign epithelia was confined to the basal cell layers, whereas in dysplasias it increasingly appeared in more superficial cell layers and showed a significant correlation with severity of dysplasia. Diffuse hWAPL expression was found in all invasive squamous cell carcinomas examined. These results demonstrate that hWAPL is associated with cell growth, and the hWAPL expression may play a significant role in cervical carcinogenesis and tumor progression.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for WAPL Antibody (NBP1-92579)(1)

Publication using NBP1-92579

• Lu X, Cui J, Fu M, Wang W Human wings apart-like gene is specifically overexpressed in cervical cancer. Oncol Lett 2016-07-01 [PMID: 27347120] (IF/IHC)

Bioinformatics

• Gene Symbol: WAPL