WAPL Antibody (3Q4G1)

Western Blot: WAPL Antibody (3Q4G1) [NBP3-16613] - Western blot analysis of extracts of various cell lines, using WAPL Rabbit mAb (NBP3-16613) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunocytochemistry/Immunofluorescence: WAPL Antibody (3Q4G1) [NBP3-16613] - Immunofluorescence analysis of NIH-3T3 cells using WAPL Rabbit mAb (NBP3-16613) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Western Blot: WAPL Antibody (3Q4G1) [NBP3-16613] - Western blot analysis of extracts of C2C12 cells, using WAPL Rabbit mAb (NBP3-16613) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunocytochemistry/ Immunofluorescence: WAPL Antibody (3Q4G1) [NBP3-16613] - Immunofluorescence analysis of HeLa cells using WAPL Rabbit mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF
• Clone: 3Q4G1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

WAPL Antibody (3Q4G1) Summary

• Description: Novus Biologicals Rabbit WAPL Antibody (3Q4G1) (NBP3-16613) is a recombinant monoclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human WAPL (Q7Z5K2). MTSRFGKTYSRKGGNGSSKFDEVFSNKRTTLSTKWGETTFMAKLGQKRPNFKPDIQEIPKKPKVEEESTGDPFGFDSDDESLPVSSKNLAQVKCSSYSES
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: WAPL
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for WAPL Antibody (3Q4G1)

• FOEKIAA0261friend of EBNA2 (Epstein-Barr virus nuclear protein 2)
• Friend of EBNA2 protein
• WAPLwings apart-like protein homolog
• wings apart-like homolog (Drosophila)

Background

The hWAPL mRNA was predominantly expressed in uterine cervical cancer, with weak expression in all other normal and tumor tissues examined. hWAPL expression in benign epithelia was confined to the basal cell layers, whereas in dysplasias it increasingly appeared in more superficial cell layers and showed a significant correlation with severity of dysplasia. Diffuse hWAPL expression was found in all invasive squamous cell carcinomas examined. These results demonstrate that hWAPL is associated with cell growth, and the hWAPL expression may play a significant role in cervical carcinogenesis and tumor progression.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: WAPL