VSIG4 Antibody - BSA Free

Lane 1: Marker [kDa] 250,130,95,72,55,36,28,17,10Lane 2: RT-4Lane 3: U-251MGLane 4: Human PlasmaLane 5: LiverLane 6: Tonsil

Staining of human lung shows cytoplasmic positivity in macrophages.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

VSIG4 Antibody - BSA Free Summary

• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein VSIG4 using the following amino acid sequence: KGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: VSIG4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 µg/ml
• Application Notes: For IHC-Paraffin, we recommend using Heat-Induced Epitope Retrieval (HIER) with a pH level of 6. This optimized retrieval method ensures the best results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for VSIG4 Antibody - BSA Free

• CRIg
• Ig superfamily protein
• Protein Z39Ig
• V-set and immunoglobulin domain containing 4
• V-set and immunoglobulin domain-containing protein 4
• VSIG4
• Z39IG
• Z39IGcomplement receptor of the immunoglobulin superfamily

Background

Phagocytic receptor, strong negative regulator of T-cell proliferation and IL2 production. Potent inhibitor of the alternative complement pathway convertases

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: VSIG4