VSIG4 Antibody

Images

 
Western Blot: VSIG4 Antibody [NBP1-69631] - This Anti-VSIG4 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 5ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VSIG4 Antibody Summary

Immunogen
Synthetic peptides corresponding to VSIG4(V-set and immunoglobulin domain containing 4) The peptide sequence was selected from the N terminal of VSIG4. Peptide sequence VPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VSIG4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against VSIG4 and was validated on Western blot.
Theoretical MW
44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for VSIG4 Antibody

  • CRIg
  • Ig superfamily protein
  • Protein Z39Ig
  • V-set and immunoglobulin domain containing 4
  • V-set and immunoglobulin domain-containing protein 4
  • VSIG4
  • Z39IG
  • Z39IGcomplement receptor of the immunoglobulin superfamily

Background

T cell activation by APCs is positively and negatively regulated by members of the B7 family. VSIG4 is a strong negative regulator of murine and human T cell proliferation and IL-2 production.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29460
Species: Hu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PAGE
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-76770
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, ICC
AF4779
Species: Hu
Applications: WB, IHC
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB110-40686
Species: Hu, Po, Bv, GP, Pm, RM, Sh
Applications: WB, ELISA, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-CS
NBP2-45549
Species: Hu
Applications: WB, Flow, IHC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-345
Species: Hu
Applications: WB, ChIP, IP
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-59072
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-Fr, IHC-P, MeDIP
AF2330
Species: Mu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF2009
Species: Hu
Applications: WB, IHC
NBP2-30536
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-69631
Species: Hu
Applications: WB

Publications for VSIG4 Antibody (NBP1-69631) (0)

There are no publications for VSIG4 Antibody (NBP1-69631).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VSIG4 Antibody (NBP1-69631) (0)

There are no reviews for VSIG4 Antibody (NBP1-69631). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VSIG4 Antibody (NBP1-69631) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VSIG4 Products

Bioinformatics Tool for VSIG4 Antibody (NBP1-69631)

Discover related pathways, diseases and genes to VSIG4 Antibody (NBP1-69631). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VSIG4 Antibody (NBP1-69631)

Discover more about diseases related to VSIG4 Antibody (NBP1-69631).
 

Pathways for VSIG4 Antibody (NBP1-69631)

View related products by pathway.

Blogs on VSIG4

There are no specific blogs for VSIG4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VSIG4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VSIG4
Entrez
Uniprot