VPS54 Antibody


Immunocytochemistry/ Immunofluorescence: VPS54 Antibody [NBP2-58379] - Staining of human cell line Hep G2 shows localization to nucleoplasm & the Golgi apparatus.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

VPS54 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VDIMVSEDMKLTDSELGKLANNIQELLYSASDICHDRAVKFLMSRAKDGFLEKLNSMEFITLSRLMETFILDTEQICGRKSTSLLGAL
Specificity of human VPS54 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
VPS54 Recombinant Protein Antigen (NBP2-58379PEP)

Reactivity Notes

Mouse 86%, Rat 89%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for VPS54 Antibody

  • HCC8SLP-8p
  • Hepatocellular carcinoma protein 8
  • hVps54L
  • Tumor antigen HOM-HCC-8
  • Tumor antigen SLP-8p
  • vacuolar protein sorting 54 (yeast)
  • vacuolar protein sorting 54 homolog (S. cerevisiae)
  • vacuolar protein sorting-associated protein 54
  • VPS54L


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, Flow, IHC-P, IP
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC

Publications for VPS54 Antibody (NBP2-58379) (0)

There are no publications for VPS54 Antibody (NBP2-58379).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS54 Antibody (NBP2-58379) (0)

There are no reviews for VPS54 Antibody (NBP2-58379). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for VPS54 Antibody (NBP2-58379) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our VPS54 Antibody and receive a gift card or discount.


Gene Symbol VPS54