VPS54 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: VPS54 Antibody [NBP2-58379] - Staining of human cell line Hep G2 shows localization to nucleoplasm & the Golgi apparatus.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VPS54 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VDIMVSEDMKLTDSELGKLANNIQELLYSASDICHDRAVKFLMSRAKDGFLEKLNSMEFITLSRLMETFILDTEQICGRKSTSLLGAL
Specificity
Specificity of human VPS54 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VPS54
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
VPS54 Recombinant Protein Antigen (NBP2-58379PEP)

Reactivity Notes

Mouse 86%, Rat 89%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for VPS54 Antibody

  • HCC8SLP-8p
  • Hepatocellular carcinoma protein 8
  • hVps54L
  • Tumor antigen HOM-HCC-8
  • Tumor antigen SLP-8p
  • vacuolar protein sorting 54 (yeast)
  • vacuolar protein sorting 54 homolog (S. cerevisiae)
  • vacuolar protein sorting-associated protein 54
  • VPS54L

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
AF6517
Species: Hu
Applications: WB
NB100-40840
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-56490
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
H00005555-P01
Species: Hu
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-30418
Species: Hu
Applications: IHC, IHC-P
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
NBP1-50323
Species: Hu
Applications: WB, ELISA, Flow, IHC-P, IP
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-14893
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC

Publications for VPS54 Antibody (NBP2-58379) (0)

There are no publications for VPS54 Antibody (NBP2-58379).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS54 Antibody (NBP2-58379) (0)

There are no reviews for VPS54 Antibody (NBP2-58379). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for VPS54 Antibody (NBP2-58379) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VPS54 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VPS54