Vitamin D BP Antibody

Images

 
Western Blot: Vitamin D Binding Protein Antibody [NBP1-88028] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human cell line A-431. ...read more
Immunohistochemistry-Paraffin: Vitamin D Binding Protein Antibody [NBP1-88028] - Staining of human kidney shows extra-cellular positivity in blood vessels and cytoplasmic positivity in cells of renal tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Vitamin D BP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCAD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Vitamin D BP Protein (NBP1-88028PEP)
Publications
Read Publication using
NBP1-88028 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24518592).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Vitamin D BP Antibody

  • DBP
  • DBP/GC
  • DBP-MAF
  • DBPVDBG
  • EC 6.3.1.5
  • Gc
  • gc-globulin
  • Gc-MAF
  • GRD3
  • group-specific component (vitamin D binding protein)
  • Group-specific component
  • hDBP
  • VDB
  • VDBG
  • VDBP
  • Vitamin D BP
  • vitamin D-binding alpha-globulin
  • vitamin D-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-22568
Species: Hu
Applications: IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-19928
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
AF7895
Species: Hu
Applications: WB, IHC
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45825
Species: Hu
Applications: WB, IHC
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-35213
Species: Hu
NBP1-88028
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Vitamin D BP Antibody (NBP1-88028)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Vitamin D BP Antibody (NBP1-88028) (0)

There are no reviews for Vitamin D BP Antibody (NBP1-88028). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Vitamin D BP Antibody (NBP1-88028) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Vitamin D BP Products

Bioinformatics Tool for Vitamin D BP Antibody (NBP1-88028)

Discover related pathways, diseases and genes to Vitamin D BP Antibody (NBP1-88028). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Vitamin D BP Antibody (NBP1-88028)

Discover more about diseases related to Vitamin D BP Antibody (NBP1-88028).
 

Pathways for Vitamin D BP Antibody (NBP1-88028)

View related products by pathway.

PTMs for Vitamin D BP Antibody (NBP1-88028)

Learn more about PTMs related to Vitamin D BP Antibody (NBP1-88028).

Blogs on Vitamin D BP

There are no specific blogs for Vitamin D BP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Vitamin D BP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GC
Entrez