VG5Q Antibody - BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human VG5Q (NP_060516.2). MASEAPSPPRSPPPPTSPEPELAQLRRKVEKLERELRSCKRQVREIEKLLHHTERLYQNAESNNQELRTQ |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
AGGF1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for VG5Q Antibody - BSA Free
Background
Angiogenic factor (vasculogenesis gene on 5q), VG5Q is a critical protein for the initiation and maintenance of the vascular system. It shows strong expression in blood vessels and is secreted as vessel formation is initiated. Increased angiogenesis is a molecular pathogenic mechanism of Klippel-Trenaunay syndrome (KTS). Thus, VG5Q has been shown to be involved in KTS.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: B/N, Func-Inh, In vitro, In vivo
Species: Hu
Applications: ChIP, ICC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: Block, IHC, WB
Species: Mu
Applications: IHC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Mu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: WB
Species: Hu
Applications: Block, IHC, Simple Western, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA, IP, WB
Species: Hu
Applications: InhibAct
Publications for VG5Q Antibody (NBP3-03503) (0)
There are no publications for VG5Q Antibody (NBP3-03503).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for VG5Q Antibody (NBP3-03503) (0)
There are no reviews for VG5Q Antibody (NBP3-03503).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for VG5Q Antibody (NBP3-03503) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional VG5Q Products
Research Areas for VG5Q Antibody (NBP3-03503)
Find related products by research area.
|
Blogs on VG5Q