RBM14 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: RBM14 Antibody [NBP1-84416] - Analysis in human testis and liver tissues using NBP1-84416 antibody. Corresponding RBM14 RNA-seq data are presented for the ...read more
Western Blot: RBM14 Antibody [NBP1-84416] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: RBM14 Antibody [NBP1-84416] - Staining of human cell line A-431 shows localization to nuclear speckles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RBM14 Antibody [NBP1-84416] - Staining of human cerebral cortex shows moderate nuclear positivity in neurons.
Western Blot: RBM14 Antibody [NBP1-84416] - Analysis in human cell line MOLT-4.
Immunohistochemistry-Paraffin: RBM14 Antibody [NBP1-84416] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: RBM14 Antibody [NBP1-84416] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: RBM14 Antibody [NBP1-84416] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

RBM14 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TQSSASLAASYAAQQHPQAAASYRGQPGNAYDGAGQPSAAYLSMSQGAVANANSTPPPYERTRLSPPRASYDDPYKKAVAMSKRYGSDRRLAELSDYRRLSESQLSFRRSPTKSSLDYRRLPDAHSDYAR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBM14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RBM14 Protein (NBP1-84416PEP)
Publications
Read Publication using
NBP1-84416 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RBM14 Antibody

  • COAAMGC31756
  • Paraspeckle protein 2
  • PSP2DKFZp779J0927
  • RNA binding motif protein 14
  • RNA-binding motif protein 14
  • RNA-binding protein 14
  • RRM-containing coactivator activator/modulator
  • SIPMGC15912
  • Synaptotagmin-interacting protein
  • SYT-interacting protein
  • SYTIP1
  • TMEM137
  • transmembrane protein 137

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87104
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-89388
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-54467
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NB100-565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
NBP1-82991
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP3-05160
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MEP00B
Species: Mu
Applications: ELISA
NBP2-67147
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF1436
Species: Mu
Applications: WB
NBP2-16389
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB200-541
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP2-48615
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-45831
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-84416
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RBM14 Antibody (NBP1-84416)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for RBM14 Antibody (NBP1-84416) (0)

There are no reviews for RBM14 Antibody (NBP1-84416). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RBM14 Antibody (NBP1-84416) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RBM14 Products

Bioinformatics Tool for RBM14 Antibody (NBP1-84416)

Discover related pathways, diseases and genes to RBM14 Antibody (NBP1-84416). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBM14 Antibody (NBP1-84416)

Discover more about diseases related to RBM14 Antibody (NBP1-84416).
 

Pathways for RBM14 Antibody (NBP1-84416)

View related products by pathway.

PTMs for RBM14 Antibody (NBP1-84416)

Learn more about PTMs related to RBM14 Antibody (NBP1-84416).
 

Research Areas for RBM14 Antibody (NBP1-84416)

Find related products by research area.

Blogs on RBM14

There are no specific blogs for RBM14, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBM14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RBM14