Home » RBM14 » RBM14 Antibodies » RBM14 Antibody

RBM14 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: RBM14 Antibody [NBP1-84416] - Analysis in human testis and liver tissues using NBP1-84416 antibody. Corresponding RBM14 RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: RBM14 Antibody [NBP1-84416] - Analysis in human testis and liver tissues using NBP1-84416 antibody. Corresponding RBM14 RNA-seq data are presented for the ...read more
Western Blot: RBM14 Antibody [NBP1-84416] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: RBM14 Antibody [NBP1-84416] - Staining of human cell line A-431 shows localization to nuclear speckles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RBM14 Antibody [NBP1-84416] - Staining of human cerebral cortex shows moderate nuclear positivity in neurons.
Western Blot: RBM14 Antibody [NBP1-84416] - Analysis in human cell line MOLT-4.
Immunohistochemistry-Paraffin: RBM14 Antibody [NBP1-84416] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: RBM14 Antibody [NBP1-84416] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: RBM14 Antibody [NBP1-84416] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

RBM14 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TQSSASLAASYAAQQHPQAAASYRGQPGNAYDGAGQPSAAYLSMSQGAVANANSTPPPYERTRLSPPRASYDDPYKKAVAMSKRYGSDRRLAELSDYRRLSESQLSFRRSPTKSSLDYRRLPDAHSDYAR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBM14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RBM14 Protein (NBP1-84416PEP)
Publications
Read Publication using
NBP1-84416 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RBM14 Antibody

  • COAAMGC31756
  • Paraspeckle protein 2
  • PSP2DKFZp779J0927
  • RNA binding motif protein 14
  • RNA-binding motif protein 14
  • RNA-binding protein 14
  • RRM-containing coactivator activator/modulator
  • SIPMGC15912
  • Synaptotagmin-interacting protein
  • SYT-interacting protein
  • SYTIP1
  • TMEM137
  • transmembrane protein 137

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CACYBP Antibody
NBP1-87104
Immunocytochemistry/Immunofluorescence: CACYBP Antibody [NBP1-87104] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Western Blot: CACYBP Antibody [NBP1-87104] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: CACYBP Antibody [NBP1-87104] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Fibronectin
Antibody - BSA Free
NBP1-91258
Immunohistochemistry-Frozen: Fibronectin Antibody [NBP1-91258] - Feline corneal stromal cells. IHC-Fr and IF (Alexa Fluor488) were performed using NBP1-91258 at 1:400. Image captured by epifluorescent microscopy. Image from verified customer review.
Western Blot: Fibronectin Antibody [NBP1-91258] - Analysis of Fibronectin in HepG2 cell lysate.
Immunohistochemistry-Frozen: Fibronectin Antibody [NBP1-91258] - Trabecular meshwork (TM) region of pig eyes. NBP1-91258 Fibronectin antibody was labelled with Alexa Fluor 488 conjugated secondary antibody (Green). DAPI shown as blue. Image from verified customer review.
(11 Reviews)
(38 Publications)
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
S100A6 Antibody
NBP1-89388
Western Blot: S100A6 Antibody [NBP1-89388] - Analysis in human cell lines PC-3 and HEK293 using anti-S100A6 antibody. Corresponding S100A6 RNA-seq data are presented for the same cell lines. Loading control: anti-PFN1.
Immunocytochemistry/Immunofluorescence: S100A6 Antibody [NBP1-89388] - Staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: S100A6 Antibody [NBP1-89388] - Staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ERK1 Antibody (1E5)
NBP2-22203
Flow Cytometry: ERK1 Antibody (1E5) [NBP2-22203] - Flow cytometric analysis of Hela cells using ERK1 mouse mAb (blue) and negative control (red).
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of paraffin-embedded bladder cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
beta-Catenin
Antibody (12F7) - BSA
NBP1-54467
Flow Cytometry: beta-Catenin Antibody (12F7) [NBP1-54467] - An intracellular stain was performed on SK-MEL-28 cells with beta-Catenin Antibody [12F7] NBP1-54467B (blue) and a matched isotype control (orange). Both antibodies were conjugated to Biotin. Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Streptavidin - R-Phycoerythrin Protein (2012-1000, Novus Biologicals).
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Analysis of beta Catenin expression in 1) HepG2, 2) MCF7, and 3) Cos7 whole cell lysates using NBP1-54467.
Immunohistochemistry: beta-Catenin Antibody (12F7) [NBP1-54467] - IF beta-Catenin staining of mouse brain tissue. This image submitted by a verified customer review.
(4 Reviews)
(16 Publications)
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
FUS Antibody
NB100-565
Immunohistochemistry-Paraffin: FUS Antibody [NB100-565] - FFPE section of human ovarian carcinoma. Affinity purified rabbit anti-FUS used at a dilution of 1:1,000 (1 ug/mL). Detection: DAB
Immunohistochemistry-Paraffin: FUS Antibody [NB100-565] - FFPE section of mouse renal cells carcinoma. Affinity purified rabbit anti-FUS used at a dilution of 1:1,000 (1 ug/mL). Detection: DA
Western Blot: FUS Antibody [NB100-565] - Whole cell lysate (50 ug) from HepG2, HeLa, 293T, and mouse NIH3T3 cells prepared using NETN lysis buffer. Affinity purified rabbit anti-FUS antibody used for WB at 0.04 ug/mL. Detection: chemiluminescence with an exposure time of 10 seconds.
(4 Reviews)
(23 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
ZEB2 Antibody
NBP1-82991
Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human cerebral cortex shows moderate nuclear positivity in glial cells.
Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human colon shows moderate nuclear positivity in a subset of lymphoid cells.
Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human glioma shows moderate nuclear positivity in tumor cells.
(2 Reviews)
(22 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
MBTPS1 Antibody
NBP3-05160
Immunocytochemistry/Immunofluorescence: MBTPS1 Antibody [NBP3-05160] - Analysis of U2OS cells using MBTPS1 antibody . Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: MBTPS1 Antibody [NBP3-05160] - Paraffin-embedded human colon cancer using MBTPS1 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: MBTPS1 Antibody [NBP3-05160] - Paraffin-embedded human stomach using MBTPS1 antibody at dilution of 1:100 (40x lens).
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
SOD1/Cu-Zn SOD
Antibody
NBP2-24915
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Human ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Bovine ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of Superoxide Dismutase 1 in FFPE human liver tissue using an isotype control (top) and NBP2-24915 (bottom) at 5 ug/ml.
(3 Reviews)
(12 Publications)
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Erythropoietin/EPO
[HRP]
MEP00B
(3 Reviews)
(94 Publications)
Species: Mu
Applications: ELISA
Skp1 Antibody
(JM27-37)
NBP2-67147
Flow Cytometry: Skp1 Antibody (JM27-37) [NBP2-67147] - Analysis of Hela cells with Skp1 antibody at 1/100 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black).
Immunocytochemistry/Immunofluorescence: Skp1 Antibody (JM27-37) [NBP2-67147] - Staining Skp1 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: Skp1 Antibody (JM27-37) [NBP2-67147] - Staining Skp1 in SH-SY5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
ALS Antibody
[Unconjugated]
AF1436
Western blot shows lysates of mouse spleen tissue, mouse liver tissue, and mouse bone marrow. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Mouse IGFALS/ALS Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1436) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for IGFALS/ALS at approximately 80-90 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(1 Publication)
Species: Mu
Applications: WB
EWSR1 Antibody
NBP2-16389
Western Blot: EWSR1 Antibody [NBP2-16389] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with EWSR1 antibody diluted at a dilution of 1:1000.
Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-16389] - Paraffin-embedded rat fore brain. EWSR1 antibody dilution: 1:500.
Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-16389] - Paraffin-embedded mouse testis. EWSR1 antibody dilution: 1:500.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Complement C4b/d
Antibody (16D2)
NB200-541
Western Blot: Complement C4b/d Antibody (16D2) [NB200-541] - Western blot analysis of C4 expression in J774.A1 (A) aand mouse PBL (B) whole cell lysates.
(7 Publications)
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot: Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) [NB100-56603] - Analysis using Azide Free version of NB100-56603. LNCaP cells (passage number 38) were serum-starved for 2 days. After serum starvation, cells were (A) left untreated, (B) treated with 100 ng/ml IGF-1 for 4h, or (C) incubated with 20 um LY294002 for 30 mi
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Phenylalanine
Hydroxylase Antibody
NBP2-48615
Western Blot: Phenylalanine Hydroxylase Antibody [NBP2-48615] - Analysis using Anti-PAH antibody NBP2-48615 (A) shows similar pattern to independent antibody NBP1-80917 (B).
Immunohistochemistry-Paraffin: Phenylalanine Hydroxylase Antibody [NBP2-48615] - Analysis in human liver and pancreas tissues. Corresponding Phenylalanine Hydroxylase RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Phenylalanine Hydroxylase Antibody [NBP2-48615] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Species: Hu
Applications: IHC, IHC-P, WB
GEMIN2 Antibody
(OTI4C11)
NBP2-45831
Western Blot: SIP1 Antibody (4C11) [NBP2-45831] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY GEMIN2 .
Immunohistochemistry: GEMIN2 Antibody (4C11) [NBP2-45831] - SIP1 Antibody (4C11) [NBP2-45831] - Analysis of Human lymph node tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)(1:150)
Immunohistochemistry: GEMIN2 Antibody (4C11) [NBP2-45831] - SIP1 Antibody (4C11) [NBP2-45831] - Analysis of Human lymphoma tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)(1:150)
Species: Hu, Mu, Rt
Applications: IHC, WB
RBM14 Antibody
NBP1-84416
RBM14 Antibody
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RBM14 Antibody (NBP1-84416)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for RBM14 Antibody (NBP1-84416) (0)

There are no reviews for RBM14 Antibody (NBP1-84416). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RBM14 Antibody (NBP1-84416) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RBM14 Products

Bioinformatics Tool for RBM14 Antibody (NBP1-84416)

Discover related pathways, diseases and genes to RBM14 Antibody (NBP1-84416). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBM14 Antibody (NBP1-84416)

Discover more about diseases related to RBM14 Antibody (NBP1-84416).
 

Pathways for RBM14 Antibody (NBP1-84416)

View related products by pathway.

PTMs for RBM14 Antibody (NBP1-84416)

Learn more about PTMs related to RBM14 Antibody (NBP1-84416).
 

Research Areas for RBM14 Antibody (NBP1-84416)

Find related products by research area.

Blogs on RBM14

There are no specific blogs for RBM14, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBM14 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol RBM14