RBM14 Antibody - BSA Free

Immunohistochemistry-Paraffin: RBM14 Antibody [NBP1-84416] - Analysis in human testis and liver tissues using NBP1-84416 antibody. Corresponding RBM14 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: RBM14 Antibody [NBP1-84416] - Staining of human cell line A-431 shows localization to nuclear speckles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: RBM14 Antibody [NBP1-84416] - Staining of human cerebral cortex shows moderate nuclear positivity in neurons.

Immunohistochemistry-Paraffin: RBM14 Antibody [NBP1-84416] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: RBM14 Antibody [NBP1-84416] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: RBM14 Antibody [NBP1-84416] - Staining of human liver shows no positivity in hepatocytes as expected.

Analysis in mouse cell line NIH-3T3.

Analysis in human cell line MOLT-4.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RBM14 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RBM14 Antibody - BSA Free (NBP1-84416) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-RBM14 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TQSSASLAASYAAQQHPQAAASYRGQPGNAYDGAGQPSAAYLSMSQGAVANANSTPPPYERTRLSPPRASYDDPYKKAVAMSKRYGSDRRLAELSDYRRLSESQLSFRRSPTKSSLDYRRLPDAHSDYAR
• Predicted Species: Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RBM14
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RBM14 Protein (NBP1-84416PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RBM14 Antibody - BSA Free

• COAAMGC31756
• Paraspeckle protein 2
• PSP2DKFZp779J0927
• RNA binding motif protein 14
• RNA-binding motif protein 14
• RNA-binding protein 14
• RRM-containing coactivator activator/modulator
• SIPMGC15912
• Synaptotagmin-interacting protein
• SYT-interacting protein
• SYTIP1
• TMEM137
• transmembrane protein 137

Background

CoAA is a RNA-binding protein. These proteins contribute to gene expression by regulating the form, abundance and stability of both coding and non-coding RNAs. In vertebrates, RNA binding proteins can also influence many processes involved in RNA processing, for example, activity-dependent transcript localization and localized protein synthesis amongst others.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RBM14 Antibody (NBP1-84416)(2)

Publications using NBP1-84416

• Tyl M, Merengwa V, Cristea I Infection-induced lysine lactylation enables herpesvirus immune evasion Science Advances 2025-01-10 [PMID: 39772686]
• Bajc Cesnik A, Darovic S, Prpar Mihevc S et al. Nuclear RNA foci from C9ORF72 expansion mutation form paraspeckle-like bodies J. Cell. Sci. 2019-02-11 [PMID: 30745340] (ICC/IF, Human)

Bioinformatics

• Gene Symbol: RBM14