VE-Cadherin Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: SLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETP |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CDH5 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for VE-Cadherin Antibody - BSA Free
Background
VE-cadherin (cadherin-5) is an endothelial specific adhesion molecule that is essential for the maintenance of endothelial barrier function and angiogenesis. VE-cadherin is linked to the actin cytoskeleton through a number of adaptor proteins including a-, â-, and ã-catenin. Cytoskeletal dynamics and phosphorylation regulate VE-cadherin mediated cell-cell adhesion. The cytosolic C-terminal Src kinase (Csk) binds via its SH2 domain to the phosphorylated tyrosine 658 site of VE-cadherin. This interaction regulates density dependent cell proliferation. Phosphorylation of tyrosine 658 has also been shown to lead to the uncoupling of p120-catenin from the cytoplasmic tail of VE-cadherin. This phosphorylation event is sufficient to maintain cells in a mesenchymal state during the cell invasion phase of angiogenesis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA, WB
Species: Rt
Applications: IHC, WB
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: BA
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: AdBlk, IHC, WB
Species: Hu
Applications: Block, IHC, Simple Western, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: WB, ICC/IF
Publications for VE-Cadherin Antibody (NBP3-21223) (0)
There are no publications for VE-Cadherin Antibody (NBP3-21223).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for VE-Cadherin Antibody (NBP3-21223) (0)
There are no reviews for VE-Cadherin Antibody (NBP3-21223).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for VE-Cadherin Antibody (NBP3-21223) (0)