VDAC2 Antibody


Western Blot: VDAC2 Antibody [NBP2-20850] - Sample (30 ug of whole cell lysate) A: HepG2 B: HCT116 12% SDS PAGE gel, diluted at 1:1000.
Immunohistochemistry-Paraffin: VDAC2 Antibody [NBP2-20850] - Immunohistochemical analysis of paraffin-embedded Colon ca, using antibody at 1:250 dilution.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

VDAC2 Antibody Summary

Recombinant protein encompassing a sequence within the center region of human VDAC2. The exact sequence is proprietary.
Mitochondrion outer membrane
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:500-1:3000
  • Immunohistochemistry 10 - 1:500
  • Immunohistochemistry-Paraffin 1:100-1:1000
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Expected cross reactivity based on sequence homology: Rhesus Monkey.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.0), 1.0% BSA and 20% Glycerol
0.01% Thimerosal
Immunogen affinity purified

Alternate Names for VDAC2 Antibody

  • FLJ23841
  • hVDAC2
  • Outer mitochondrial membrane protein porin 2
  • POR
  • VDAC-2
  • voltage-dependent anion channel 2
  • voltage-dependent anion-selective channel protein 2


This gene encodes a member of the voltage-dependent anion channel pore-forming family of proteins that are considered the main pathway for metabolite diffusion across the mitochondrial outer membrane. The encoded protein is also thought to be involved in the mitochondrial apoptotic pathway via regulation of BCL2-antagonist/killer 1 protein activity. Pseudogenes have been identified on chromosomes 1, 2, 12 and 21, and alternative splicing results in multiple transcript variants. [provided by RefSeq]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Av, Bv, Fi, Gt, Ma, Re
Applications: WB, ELISA, IHC
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P

Publications for VDAC2 Antibody (NBP2-20850) (0)

There are no publications for VDAC2 Antibody (NBP2-20850).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VDAC2 Antibody (NBP2-20850) (0)

There are no reviews for VDAC2 Antibody (NBP2-20850). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VDAC2 Antibody (NBP2-20850). (Showing 1 - 1 of 1 FAQ).

  1. Could you tell me if this antibody has a chance to recognize the sea urchin sequence according to the amino acid identity with the immunogen? Here is the sequence of the sea urchin VDAC2: MAVPSSYSDLGKAARDIFGKGFGFGFVKLDAKTTTSNNVGFTVSSASNNDTGKVDASLETKYSWKE
    • unfortunately, it does not look like we have any VDAC2 antibodies that I would recommend for use in sea urchin. A majority of our VDAC2 antibodies are made to the human sequence, which only shares 66% homology with the sea urchin sequence. While there are small spans of homology, I do not believe there is enough for recognition.

Secondary Antibodies


Isotype Controls

Additional VDAC2 Products

Bioinformatics Tool for VDAC2 Antibody (NBP2-20850)

Discover related pathways, diseases and genes to VDAC2 Antibody (NBP2-20850). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VDAC2 Antibody (NBP2-20850)

Discover more about diseases related to VDAC2 Antibody (NBP2-20850).

Pathways for VDAC2 Antibody (NBP2-20850)

View related products by pathway.

PTMs for VDAC2 Antibody (NBP2-20850)

Learn more about PTMs related to VDAC2 Antibody (NBP2-20850).

Research Areas for VDAC2 Antibody (NBP2-20850)

Find related products by research area.

Blogs on VDAC2

There are no specific blogs for VDAC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our VDAC2 Antibody and receive a gift card or discount.


Gene Symbol VDAC2