VDAC2 Antibody


Western Blot: VDAC2 Antibody [NBP2-20850] - Sample (30 ug of whole cell lysate) A: HepG2 B: HCT116 12% SDS PAGE gel, diluted at 1:1000.
Immunohistochemistry-Paraffin: VDAC2 Antibody [NBP2-20850] - Immunohistochemical analysis of paraffin-embedded Colon ca, using antibody at 1:250 dilution.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
1 mg/ml

Order Details

VDAC2 Antibody Summary

Recombinant fragment corresponding to a region within amino acids 1 and 229 of VDAC2 (Uniprot ID#P45880)
Mitochondrion outer membrane
Predicted Species
Bovine (100%), Rabbit (100%), Primate (100%)
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
1XPBS, 1%BSA, 20% Glycerol (pH7).
0.01% Thimerosal
1 mg/ml
Immunogen affinity purified


Application Notes
suggested antigen retrieval using heat mediated 10mM Citrate buffer (pH6.0) or Tris-EDTA buffer (pH8.0)

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
32 kDa

Reactivity Notes

Human. Species reactivity based on sequence identity: Rabbit (100%), Bovine (100%), Rhesus Monkey (100%).

Alternate Names for VDAC2 Antibody

  • FLJ23841
  • hVDAC2
  • Outer mitochondrial membrane protein porin 2
  • POR
  • VDAC-2
  • voltage-dependent anion channel 2
  • voltage-dependent anion-selective channel protein 2


This gene encodes a member of the voltage-dependent anion channel pore-forming family of proteins that are considered the main pathway for metabolite diffusion across the mitochondrial outer membrane. The encoded protein is also thought to be involved in the mitochondrial apoptotic pathway via regulation of BCL2-antagonist/killer 1 protein activity. Pseudogenes have been identified on chromosomes 1, 2, 12 and 21, and alternative splicing results in multiple transcript variants. [provided by RefSeq]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Av, Bv, Fi, Gt, Ma, Re
Applications: WB, ELISA, IHC
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Pm, Rb
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IP, DirELISA
Species: Hu, Bovine, Primate, Rabbit
Applications: WB, IHC, IHC-P

Publications for VDAC2 Antibody (NBP2-20850) (0)

There are no publications for VDAC2 Antibody (NBP2-20850).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VDAC2 Antibody (NBP2-20850) (0)

There are no reviews for VDAC2 Antibody (NBP2-20850). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VDAC2 Antibody (NBP2-20850). (Showing 1 - 1 of 1 FAQ).

  1. Could you tell me if this antibody has a chance to recognize the sea urchin sequence according to the amino acid identity with the immunogen? Here is the sequence of the sea urchin VDAC2: MAVPSSYSDLGKAARDIFGKGFGFGFVKLDAKTTTSNNVGFTVSSASNNDTGKVDASLETKYSWKE
    • unfortunately, it does not look like we have any VDAC2 antibodies that I would recommend for use in sea urchin. A majority of our VDAC2 antibodies are made to the human sequence, which only shares 66% homology with the sea urchin sequence. While there are small spans of homology, I do not believe there is enough for recognition.

Secondary Antibodies


Isotype Controls

Additional VDAC2 Antibody Products

Related Products by Gene

Bioinformatics Tool for VDAC2 Antibody (NBP2-20850)

Discover related pathways, diseases and genes to VDAC2 Antibody (NBP2-20850). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VDAC2 Antibody (NBP2-20850)

Discover more about diseases related to VDAC2 Antibody (NBP2-20850).

Pathways for VDAC2 Antibody (NBP2-20850)

View related products by pathway.

PTMs for VDAC2 Antibody (NBP2-20850)

Learn more about PTMs related to VDAC2 Antibody (NBP2-20850).

Research Areas for VDAC2 Antibody (NBP2-20850)

Find related products by research area.

Blogs on VDAC2

There are no specific blogs for VDAC2, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol VDAC2

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP2-20850 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought