VDAC2 Antibody Summary
| Immunogen |
Recombinant protein encompassing a sequence within the center region of human VDAC2. The exact sequence is proprietary. |
| Localization |
Mitochondrion outer membrane |
| Predicted Species |
Rat (96%), Porcine (99%), Rabbit (100%), Bovine (100%), Rhesus Macaque (100%), Chicken (91%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
VDAC2 |
| Purity |
Antigen Affinity-purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:100-1:1000
- Immunohistochemistry-Paraffin 1:100-1:1000
- Western Blot 1:500-1:3000
|
| Theoretical MW |
32 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Reactivity Notes
Zebrafish (83%), Xenopus laevis (86%).
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 1% BSA, 20% Glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Antigen Affinity-purified |
Alternate Names for VDAC2 Antibody
Background
This gene encodes a member of the voltage-dependent anion channel pore-forming family of proteins that are considered the main pathway for metabolite diffusion across the mitochondrial outer membrane. The encoded protein is also thought to be involved in the mitochondrial apoptotic pathway via regulation of BCL2-antagonist/killer 1 protein activity. Pseudogenes have been identified on chromosomes 1, 2, 12 and 21, and alternative splicing results in multiple transcript variants. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Fi, Hu, Mu, Rt
Applications: ELISA, IHC, KD, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Pm
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: DirELISA, IP, WB
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
⚠ WARNING: This product can expose you to chemicals including mercury, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information go to www.P65Warnings.ca.gov.
Publications for VDAC2 Antibody (NBP2-20850) (0)
There are no publications for VDAC2 Antibody (NBP2-20850).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for VDAC2 Antibody (NBP2-20850) (0)
There are no reviews for VDAC2 Antibody (NBP2-20850).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for VDAC2 Antibody (NBP2-20850). (Showing 1 - 1 of 1 FAQ).
-
Could you tell me if this antibody has a chance to recognize the sea urchin sequence according to the amino acid identity with the immunogen? Here is the sequence of the sea urchin VDAC2: MAVPSSYSDLGKAARDIFGKGFGFGFVKLDAKTTTSNNVGFTVSSASNNDTGKVDASLETKYSWKE
- unfortunately, it does not look like we have any VDAC2 antibodies that I would recommend for use in sea urchin. A majority of our VDAC2 antibodies are made to the human sequence, which only shares 66% homology with the sea urchin sequence. While there are small spans of homology, I do not believe there is enough for recognition.
Secondary Antibodies
| |
Isotype Controls
|
Additional VDAC2 Products
Research Areas for VDAC2 Antibody (NBP2-20850)
Find related products by research area.
|
Blogs on VDAC2