VDAC2 Antibody

Western Blot: VDAC2 Antibody [NBP2-20850] - Sample (30 ug of whole cell lysate) A: HepG2 B: HCT116 12% SDS PAGE gel, diluted at 1:1000.

Immunohistochemistry-Paraffin: VDAC2 Antibody [NBP2-20850] - Immunohistochemical analysis of paraffin-embedded Colon ca, using antibody at 1:250 dilution.

Western Blot: VDAC2 Antibody [NBP2-20850] - Various tissue extracts (50 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with VDAC2 antibody [N1C2] (NBP2-20850) diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.

• Reactivity: Hu, Mu, Rt, Rt, Po, Bv, Ch, Rb, RM
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

VDAC2 Antibody Summary

• Description: Novus Biologicals Rabbit VDAC2 Antibody (NBP2-20850) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant protein encompassing a sequence within the center region of human VDAC2. The exact sequence is proprietary.
• Localization: Mitochondrion outer membrane
• Predicted Species: Rat (96%), Porcine (99%), Rabbit (100%), Bovine (100%), Rhesus Macaque (100%), Chicken (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: VDAC2
• Purity: Antigen Affinity-purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:100-1:1000
  • Immunohistochemistry-Paraffin 1:100-1:1000
  • Western Blot 1:500-1:3000
• Theoretical MW: 32 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Zebrafish (83%), Xenopus laevis (86%).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS, 1% BSA, 20% Glycerol
• Preservative: 0.01% Thimerosal
• Purity: Antigen Affinity-purified

Alternate Names for VDAC2 Antibody

• FLJ23841
• hVDAC2
• Outer mitochondrial membrane protein porin 2
• POR
• VDAC-2
• voltage-dependent anion channel 2
• voltage-dependent anion-selective channel protein 2

Background

This gene encodes a member of the voltage-dependent anion channel pore-forming family of proteins that are considered the main pathway for metabolite diffusion across the mitochondrial outer membrane. The encoded protein is also thought to be involved in the mitochondrial apoptotic pathway via regulation of BCL2-antagonist/killer 1 protein activity. Pseudogenes have been identified on chromosomes 1, 2, 12 and 21, and alternative splicing results in multiple transcript variants. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including mercury, which is known to the State of California to cause reproductive toxicity with developmental effects.  For more information go to www.P65Warnings.ca.gov.

FAQs for VDAC2 Antibody (NBP2-20850). (Showing 1 - 1 of 1 FAQ).

1. Could you tell me if this antibody has a chance to recognize the sea urchin sequence according to the amino acid identity with the immunogen? Here is the sequence of the sea urchin VDAC2: MAVPSSYSDLGKAARDIFGKGFGFGFVKLDAKTTTSNNVGFTVSSASNNDTGKVDASLETKYSWKE
   • unfortunately, it does not look like we have any VDAC2 antibodies that I would recommend for use in sea urchin. A majority of our VDAC2 antibodies are made to the human sequence, which only shares 66% homology with the sea urchin sequence. While there are small spans of homology, I do not believe there is enough for recognition.

Bioinformatics

• Gene Symbol: VDAC2
• Uniprot:
  • P45880(Human)