VDAC3 Antibody

Images

 
Western Blot: VDAC3 Antibody [NBP1-80070] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Immunohistochemistry: VDAC3 Antibody [NBP1-80070] - Human Lung cell Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.
Western Blot: VDAC3 Antibody [NBP1-80070] - Human Heart lysate, concentration 0.2-1 ug/ml.
Western Blot: VDAC3 Antibody [NBP1-80070] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml VDAC3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Western Blot: VDAC3 Antibody [NBP1-80070] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VDAC3 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human VDAC3. Peptide sequence: KWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCF
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VDAC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against VDAC3 and was validated on Western blot.
Positive Control
VDAC3 Lysate (NBP2-65481)

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for VDAC3 Antibody

  • HD-VDAC3
  • hVDAC3
  • Outer mitochondrial membrane protein porin 3
  • VDAC-3
  • voltage-dependent anion channel 3
  • voltage-dependent anion-selective channel protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-695
Species: Hu, Av, Bv, Fi, Ma, Re
Applications: WB, ELISA, IHC
NBP2-20849
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-91790
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P
NBP2-32020
Species: Hu
Applications: IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-56092
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB500-181
Species: Hu, Mu, Rt, Po, Dr
Applications: WB, ICC/IF, IP
NBP2-24482
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
NBP1-89172
Species: Hu
Applications: WB, IHC, IHC-P
H00011214-M10
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-57033
Species: Hu
Applications: WB
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37250
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready

Publications for VDAC3 Antibody (NBP1-80070) (0)

There are no publications for VDAC3 Antibody (NBP1-80070).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VDAC3 Antibody (NBP1-80070) (0)

There are no reviews for VDAC3 Antibody (NBP1-80070). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VDAC3 Antibody (NBP1-80070) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for VDAC3 Antibody (NBP1-80070)

Discover related pathways, diseases and genes to VDAC3 Antibody (NBP1-80070). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VDAC3 Antibody (NBP1-80070)

Discover more about diseases related to VDAC3 Antibody (NBP1-80070).
 

Pathways for VDAC3 Antibody (NBP1-80070)

View related products by pathway.

PTMs for VDAC3 Antibody (NBP1-80070)

Learn more about PTMs related to VDAC3 Antibody (NBP1-80070).

Blogs on VDAC3

There are no specific blogs for VDAC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VDAC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VDAC3
Uniprot