VDAC3 Antibody

Images

 
Western Blot: VDAC3 Antibody [NBP1-80070] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.
Immunohistochemistry: VDAC3 Antibody [NBP1-80070] - Human Lung cell Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.
Western Blot: VDAC3 Antibody [NBP1-80070] - Human Heart lysate, concentration 0.2-1 ug/ml.
Western Blot: VDAC3 Antibody [NBP1-80070] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml VDAC3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Western Blot: VDAC3 Antibody [NBP1-80070] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

VDAC3 Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptide directed towards the N terminal of human VDAC3. Peptide sequence: KWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCF The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VDAC3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
Publications
Read Publication using
NBP1-80070 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for VDAC3 Antibody

  • HD-VDAC3
  • hVDAC3
  • Outer mitochondrial membrane protein porin 3
  • VDAC-3
  • voltage-dependent anion channel 3
  • voltage-dependent anion-selective channel protein 3

Background

The Voltage-Dependant Anion Channel (VDAC3) of the outer mitochondrial membrane, a small abundant protein found in all eukaryotic kingdoms, forms a voltage-gated pore when incorporated into planar lipid bilayers. VDAC is also the site of binding of the metabolic enzymes hexokinase and glycerol kinase to the mitochondrion in what may be a significant metabolic regulatory interaction. VDAC3 is involved specifically in translocation of adenine nucleotides through the outer membrane.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for VDAC3 Antibody (NBP1-80070)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for VDAC3 Antibody (NBP1-80070) (0)

There are no reviews for VDAC3 Antibody (NBP1-80070). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VDAC3 Antibody (NBP1-80070) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VDAC3 Products

Research Areas for VDAC3 Antibody (NBP1-80070)

Find related products by research area.

Blogs on VDAC3

There are no specific blogs for VDAC3, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VDAC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VDAC3
Uniprot