VAV3 Antibody (9A10D8) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 700-800 of human VAV3 (Q9UKW4). TKESGEYAISIKYNNEAKHIKILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHSAGQRGNRAGNSLLSPKVLGIAIARYDFC |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
VAV3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin
- Western Blot 1:100 - 1:500
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for VAV3 Antibody (9A10D8)
Background
The Vav family are Rho/Rac guanosine nucleotide exchange factors (GEFs), consisting of three members in mammalian cells (Vav, Vav2, Vav3) and one in nematodes (CelVav) (1). Vav3 is expressed in most hematopoietic cells and non-hematopoietic tissues except ovary and skeletal muscles. T-cell stimulated and tyrosine phosphorylated Vav3 acts as an exchange factor for GTP-binding proteins RhoA, RhoG, and Rac1 (2). Also, tyrosine phosphorylated Vav3 mediates RTK signalizing, specifically IR, IGFR, and EGFR-mediated signaling pathways. Vav3 has been linked to as a factor for cell morphology modulation and an inducer for cell transformation (3).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC, Simple Western, WB
Species: Ca, Hu, Pm
Applications: WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Pm
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Publications for VAV3 Antibody (NBP3-16615) (0)
There are no publications for VAV3 Antibody (NBP3-16615).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for VAV3 Antibody (NBP3-16615) (0)
There are no reviews for VAV3 Antibody (NBP3-16615).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for VAV3 Antibody (NBP3-16615) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional VAV3 Products
Research Areas for VAV3 Antibody (NBP3-16615)
Find related products by research area.
|
Blogs on VAV3