VAMP-7 Antibody - Azide and BSA Free

Western Blot: VAMP-7 Antibody [NBP3-15595] - analysis of various lysates, using VAMP7 antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 60s.

Western Blot: VAMP-7 Antibody [NBP3-15595] -analysis of Mouse brain, using VAMP7 antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit. Exposure time: 180s.

Immunocytochemistry/Immunofluorescence: VAMP-7 Antibody [NBP3-15595] - Immunofluorescence analysis of C6 cells using VAMP-7 antibody (NBP3-15595) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: VAMP-7 Antibody [NBP3-15595] - Immunofluorescence analysis of U2OS cells using VAMP-7 antibody (NBP3-15595) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: VAMP-7 Antibody - Azide and BSA Free [VAMP-7] - Immunofluorescence analysis of NIH/3T3 cells using VAMP-7 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

VAMP-7 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit VAMP-7 Antibody - Azide and BSA Free (NBP3-15595) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 11-70 of human VAMP-7 (P51809). GTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: VAMP7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:100 - 1:500

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for VAMP-7 Antibody - Azide and BSA Free

• FLJ54296
• SYBL1
• SYBL1FLJ53762
• synaptobrevin-like 1
• Synaptobrevin-like protein 1
• tetanus neurotoxin-insensitive VAMP
• Tetanus-insensitive VAMP
• TIVAMP
• TI-VAMP
• VAMP7
• VAMP-7
• VAMP-7FLJ53045
• vesicle-associated membrane protein 7

Background

Involved in the targeting and/or fusion of transport vesicles to their target membrane during transport of proteins from the early endosome to the lysosome. Required for heterotypic fusion of late endosomes with lysosomes and homotypic lysosomal fusion. Required for calcium regulated lysosomal exocytosis. Involved in the export of chylomicrons from the endoplasmic reticulum to the cis Golgi. Required for exocytosis of mediators during eosinophil and neutrophil degranulation, and target cell killing by natural killer cells. Required for focal exocytosis of late endocytic vesicles during phagosome formation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: VAMP7