ANKRD27 Antibody

Images

 
Western Blot: ANKRD27 Antibody [NBP2-87002] - Host: Rabbit. Target Name: ANKRD27. Sample Type: Human Jurkat. Antibody Dilution: 1.0ug/mlANKRD27 is supported by BioGPS gene expression data to be expressed in Jurkat
Western Blot: ANKRD27 Antibody [NBP2-87002] - WB Suggested Anti-ANKRD27 Antibody. Titration: 1.0 ug/ml. Positive Control: MCF7 Whole CellANKRD27 is supported by BioGPS gene expression data to be expressed in MCF7

Product Details

Summary
Reactivity Hu, Mu, Ca, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ANKRD27 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human ANKRD27. Peptide sequence: DSISQESSTSSFSSMSASSRQEETKKDYREVEKLLRAVADGDLEMVRYLL The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (91%), Rabbit (93%), Canine (93%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
ANKRD27
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ANKRD27 Antibody

  • ankyrin repeat domain 27 (VPS9 domain)
  • ankyrin repeat domain-containing protein 27
  • DKFZp434L0718
  • FLJ00040
  • VARP
  • Vps9 domain and ankyrin-repeat-containing protein
  • VPS9 domain-containing protein
  • VPS9-ankyrin-repeat protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6117
Species: Hu
Applications: WB, IHC
NBP2-45497
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IF
NBP1-88370
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF6260
Species: Hu
Applications: WB
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-95233
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85968
Species: Hu
Applications: WB, IHC, IHC-P
H00023682-M02
Species: Hu
Applications: WB, ELISA, S-ELISA
NB120-13253
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-15087
Species: Hu, Mu
Applications: WB
H00009322-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-66897
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-695
Species: Hu, Mu, Rt, Fi
Applications: WB, ELISA, IHC, KD
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33414
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ANKRD27 Antibody (NBP2-87002) (0)

There are no publications for ANKRD27 Antibody (NBP2-87002).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKRD27 Antibody (NBP2-87002) (0)

There are no reviews for ANKRD27 Antibody (NBP2-87002). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ANKRD27 Antibody (NBP2-87002) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ANKRD27 Products

Bioinformatics Tool for ANKRD27 Antibody (NBP2-87002)

Discover related pathways, diseases and genes to ANKRD27 Antibody (NBP2-87002). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ANKRD27 Antibody (NBP2-87002)

View related products by pathway.

Blogs on ANKRD27

There are no specific blogs for ANKRD27, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ANKRD27 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANKRD27