NSF Antibody

Images

 
Western Blot: NSF Antibody [NBP1-87035] - Analysis in control (vector only transfected HEK293T lysate) and NSF over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: NSF Antibody [NBP1-87035] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: NSF Antibody [NBP1-87035] - Staining of human cerebral cortex shows strong positivity in neuropil.
Western Blot: NSF Antibody [NBP1-87035] - Analysis in human cell line A-549.
Immunohistochemistry-Paraffin: NSF Antibody [NBP1-87035] - Staining of human testis shows cytoplasmic positivity in cells of seminiferus ducts.
Immunohistochemistry-Paraffin: NSF Antibody [NBP1-87035] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: NSF Antibody [NBP1-87035] - Staining of human liver shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: NSF Antibody [NBP1-87035] - Staining in human cerebral cortex and liver tissues using anti-NSF antibody. Corresponding NSF RNA-seq data are presented for the ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: NSF Antibody [NBP1-87035] - Analysis in human cerebral cortex and liver tissues. Corresponding NSF RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: NSF Antibody [NBP1-87035] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Details

Summary
Reactivity Hu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

NSF Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KVEVDMEKAESLQVTRGDFLASLENDIKPAFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIKICSPDK
Specificity
Specificity of human NSF antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NSF
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100
Control Peptide
Publications
Read Publication using
NBP1-87035 in the following applications:

  • IF
    1 publication

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 24443234).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NSF Antibody

  • EC 3.6.4.6
  • NEM-sensitive fusion protein
  • N-ethylmaleimide-sensitive factor
  • N-ethylmaleimide-sensitive factor-like protein
  • N-ethylmaleimide-sensitive fusion protein
  • SKD2
  • vesicle-fusing ATPase
  • Vesicular-fusion protein NSF

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88769
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-32493
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-595
Species: Mu, Rt, Bv, Pm
Applications: WB, Flow, IHC, IHC-P, IP, IF
NBP2-33414
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-1558
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
MAB7237
Species: Hu
Applications: WB, IHC
NB300-124
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
H00008773-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NB300-510
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
NBP1-83139
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91499
Species: Mu
Applications: WB, ICC/IF, IHC
NBP1-86101
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-41403
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-41387
Species: Hu
Applications: WB, ELISA, EIA, IHC, IHC-P, PEP-ELISA, S-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87374
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-1483
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, PEP-ELISA, PLA

Publications for NSF Antibody (NBP1-87035)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: IF.


Filter By Application
IF
(1)
All Applications
Filter By Species
Rat
(1)
All Species

Reviews for NSF Antibody (NBP1-87035) (0)

There are no reviews for NSF Antibody (NBP1-87035). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NSF Antibody (NBP1-87035) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NSF Products

Bioinformatics Tool for NSF Antibody (NBP1-87035)

Discover related pathways, diseases and genes to NSF Antibody (NBP1-87035). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NSF Antibody (NBP1-87035)

Discover more about diseases related to NSF Antibody (NBP1-87035).
 

Pathways for NSF Antibody (NBP1-87035)

View related products by pathway.

PTMs for NSF Antibody (NBP1-87035)

Learn more about PTMs related to NSF Antibody (NBP1-87035).

Blogs on NSF

There are no specific blogs for NSF, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NSF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NSF
Novus 100% Guarantee