Syntaxin 7 Antibody

Images

 
Western Blot: Syntaxin 7 Antibody [NBP1-87497] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunocytochemistry/ Immunofluorescence: Syntaxin 7 Antibody [NBP1-87497] - Staining of human cell line U-251 MG shows localization to lysosomes.
Immunohistochemistry-Paraffin: Syntaxin 7 Antibody [NBP1-87497] - Staining of human tonsil shows strong cytoplasmic positivity in germinal and non germinal center cells.
Western Blot: Syntaxin 7 Antibody [NBP1-87497] - Analysis in human cell line Daudi.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Syntaxin 7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GVGGDPAQLAQRISSNIQKITQCSVEIQRTLNQLGTPQDSPELRQQLQQKQQYTNQLAKETDKYIKEFGSLPTTPSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVARVRASSRVSGSFPEDSSKERNLVSWESQTQPQV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STX7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Syntaxin 7 Protein (NBP1-87497PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-87497 in the following applications:

Publications
Read Publication using NBP1-87497.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Syntaxin 7 Antibody

  • STX7
  • Syntaxin 7
  • syntaxin-7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33414
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5448
Species: Hu, Mu, Rt
Applications: WB, IHC
AF5354
Species: Hu
Applications: WB, IHC
MAB6117
Species: Hu
Applications: WB, IHC
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7237
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-15131
Species: Hu
Applications: WB
NBP2-45413
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC
AF5664
Species: Hu
Applications: WB, IHC, ICC
NB300-510
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
MAB25031
Species: Hu
Applications: WB, IHC, IP
NB110-74682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82785
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-30914
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-86985
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87497
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Syntaxin 7 Antibody (NBP1-87497)(1)

Review for Syntaxin 7 Antibody (NBP1-87497) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-87497:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Syntaxin 7 NBP1-87497
Enlarge
reviewed by:
Scott Messenger
WB Human 04/25/2017
View

Summary

ApplicationWestern Blot
Sample TestedT84 human colon carcinoma cell line
SpeciesHuman

Comments

Comments100 ug whole cell lysate, 15% gel

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Syntaxin 7 Antibody (NBP1-87497) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Syntaxin 7 Products

Bioinformatics Tool for Syntaxin 7 Antibody (NBP1-87497)

Discover related pathways, diseases and genes to Syntaxin 7 Antibody (NBP1-87497). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Syntaxin 7 Antibody (NBP1-87497)

Discover more about diseases related to Syntaxin 7 Antibody (NBP1-87497).
 

Pathways for Syntaxin 7 Antibody (NBP1-87497)

View related products by pathway.

PTMs for Syntaxin 7 Antibody (NBP1-87497)

Learn more about PTMs related to Syntaxin 7 Antibody (NBP1-87497).
 

Research Areas for Syntaxin 7 Antibody (NBP1-87497)

Find related products by research area.

Blogs on Syntaxin 7

There are no specific blogs for Syntaxin 7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Scott Messenger
04/25/2017
Application: WB
Species: Human

Bioinformatics

Gene Symbol STX7
Entrez