Syntaxin 4 Antibody - BSA Free

Western Blot: Syntaxin 4 Antibody [NBP1-87374] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-STX4 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Immunocytochemistry/Immunofluorescence: Syntaxin 4 Antibody [NBP1-87374] - Staining of human cell line U-251 MG shows localization to plasma membrane. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Syntaxin 4 Antibody [NBP1-87374] - Staining of human skin shows strong membranous positivity in squamous epithelial cells.

Western Blot: Syntaxin 4 Antibody [NBP1-87374] - Analysis in human cell line MCF-7.

Immunohistochemistry-Paraffin: Syntaxin 4 Antibody [NBP1-87374] - Staining of human lymphoid tissues shows strong membranous positivity in germinal center cells.

Immunohistochemistry-Paraffin: Syntaxin 4 Antibody [NBP1-87374] - Staining of human gastrointestinal shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: Syntaxin 4 Antibody [NBP1-87374] - Staining of human prostate shows strong membranous positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Syntaxin 4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Syntaxin 4 Antibody - BSA Free (NBP1-87374) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Syntaxin 4 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MRDRTHELRQGDDSSDEEDKERVALVVHPGTARLGSPDEEFFHKVRTIRQTIVKLGNKVQELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINKCNSMQSE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STX4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: PFA/Triton X-100
• Theoretical MW: 34 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  Syntaxin 4 Protein (NBP1-87374PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (86%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Syntaxin 4 Antibody - BSA Free

• NY-REN-31
• p35-2
• Renal carcinoma antigen NY-REN-31
• STX4
• STX4Ap35-2
• Syntaxin 4
• syntaxin 4A (placental)
• syntaxin-4

Background

Plasma membrane t-SNARE that mediates docking of transport vesicles. Necessary for the translocation of SLC2A4 from intracellular vesicles to the plasma membrane. Together with STXB3 and VAMP2, may also play a role in docking/fusion of intracellular GLUT4-containing vesicles with the cell surface in adipocytes . May also play a role in docking of synaptic vesicles at presynaptic active zones

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Syntaxin 4 Antibody (NBP1-87374)(4)

Publications using NBP1-87374

• Ly T, Pickard B, Pandey A et al. TRIM16 mediates secretory autophagy in head and neck cancer-associated fibroblasts Autophagy 2025-05-22 [PMID: 40383937]
• Schindler C, Chen Y, Pu J et al. EARP is a multisubunit tethering complex involved in endocytic recycling. Nat Cell Biol 2015-05-01 [PMID: 25799061]
• Campbell-Valois FX, Trost M, Chemali M et al. Quantitative Proteomics Reveals That Only a Subset of the Endoplasmic Reticulum Contributes to the Phagosome. Mol Cell Proteomics 2012-07-01 [PMID: 22427703]
• Rivero R, Garin CA, Ormazabal P et al. Protein expression of PKCZ (Protein Kinase C Zeta), Munc18c, and Syntaxin-4 in the insulin pathway in endometria of patients with polycystic ovary syndrome (PCOS). Reprod Biol Endocrinol 2012-03-01 [PMID: 22390153]

Bioinformatics

• Gene Symbol: STX4
• Entrez:
  • 6810(Human)
• Uniprot:
  • Q12846()