Syntaxin 4 Antibody

Images

 
Western Blot: Syntaxin 4 Antibody [NBP1-87374] - Analysis in human cell line MCF-7.
Immunocytochemistry/ Immunofluorescence: Syntaxin 4 Antibody [NBP1-87374] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane.
Immunohistochemistry-Paraffin: Syntaxin 4 Antibody [NBP1-87374] - Staining of human skin shows membranous positivity in epidermal cells.
Immunohistochemistry-Paraffin: Syntaxin 4 Antibody [NBP1-87374] - Staining of human tonsil shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction center.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Syntaxin 4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MRDRTHELRQGDDSSDEEDKERVALVVHPGTARLGSPDEEFFHKVRTIRQTIVKLGNKVQELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINKCNSMQSE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STX4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Immunofluorescence
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Syntaxin 4 Protein (NBP1-87374PEP)
Publications
Read Publications using NBP1-87374.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (86%). Reactivity reported in scientific literature (PMID: 22427703)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Syntaxin 4 Antibody

  • NY-REN-31
  • p35-2
  • Renal carcinoma antigen NY-REN-31
  • STX4
  • STX4Ap35-2
  • Syntaxin 4
  • syntaxin 4A (placental)
  • syntaxin-4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83162
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
AF5659
Species: Hu
Applications: WB
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB300-510
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15131
Species: Hu
Applications: WB
AF5354
Species: Hu
Applications: WB, IHC
NBP2-33414
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7237
Species: Hu, Mu, Rt
Applications: WB, ICC
MAB2568
Species: Mu
Applications: WB, IHC
MAB6117
Species: Hu
Applications: WB, IHC
NBP1-86101
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF4828
Species: Hu, Mu
Applications: WB, IHC
AF6386
Species: Hu
Applications: WB, IP
NBP1-84168
Species: Hu
Applications: IHC, IHC-P

Publications for Syntaxin 4 Antibody (NBP1-87374)(3)

Reviews for Syntaxin 4 Antibody (NBP1-87374) (0)

There are no reviews for Syntaxin 4 Antibody (NBP1-87374). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Syntaxin 4 Antibody (NBP1-87374) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Syntaxin 4 Products

Bioinformatics Tool for Syntaxin 4 Antibody (NBP1-87374)

Discover related pathways, diseases and genes to Syntaxin 4 Antibody (NBP1-87374). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Syntaxin 4 Antibody (NBP1-87374)

Discover more about diseases related to Syntaxin 4 Antibody (NBP1-87374).
 

Pathways for Syntaxin 4 Antibody (NBP1-87374)

View related products by pathway.

Blogs on Syntaxin 4

There are no specific blogs for Syntaxin 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Syntaxin 4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STX4
Entrez
Uniprot