Synaptobrevin homolog YKT6 Antibody

Images

 
Western Blot: Synaptobrevin homolog YKT6 Antibody [NBP1-87439] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: Synaptobrevin homolog YKT6 Antibody [NBP1-87439] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Synaptobrevin homolog YKT6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LCHVYVRNDSLAGVVIADNEYPSRVAFTLLEKVLDEFSKQVDRIDWPVGSPATIHYPALDGHLSRYQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
YKT6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Synaptobrevin homolog YKT6 Protein (NBP1-87439PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Synaptobrevin homolog YKT6 Antibody

  • EC 2.3.1
  • EC 2.3.1.-
  • R-SNARE
  • S. cerevisiae, homolog of
  • SNARE protein Ykt6
  • synaptobrevin homolog YKT6
  • YKT6 v-SNARE homolog (S. cerevisiae)
  • YKT6 v-SNARE protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6117
Species: Hu
Applications: WB, IHC
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-82785
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF5687
Species: Hu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-33414
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-510
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
H00009527-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-47379
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5354
Species: Hu
Applications: WB, IHC
NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
NB100-91277
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBL1-07969
Species: Hu
NBP1-83162
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86731
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1448
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
NBP1-87374
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-56176
Species: Hu
Applications: ICC/IF
NBP2-13512
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Synaptobrevin homolog YKT6 Antibody (NBP1-87439) (0)

There are no publications for Synaptobrevin homolog YKT6 Antibody (NBP1-87439).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Synaptobrevin homolog YKT6 Antibody (NBP1-87439) (0)

There are no reviews for Synaptobrevin homolog YKT6 Antibody (NBP1-87439). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Synaptobrevin homolog YKT6 Antibody (NBP1-87439) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Synaptobrevin homolog YKT6 Products

Bioinformatics Tool for Synaptobrevin homolog YKT6 Antibody (NBP1-87439)

Discover related pathways, diseases and genes to Synaptobrevin homolog YKT6 Antibody (NBP1-87439). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Synaptobrevin homolog YKT6 Antibody (NBP1-87439)

Discover more about diseases related to Synaptobrevin homolog YKT6 Antibody (NBP1-87439).
 

Pathways for Synaptobrevin homolog YKT6 Antibody (NBP1-87439)

View related products by pathway.

PTMs for Synaptobrevin homolog YKT6 Antibody (NBP1-87439)

Learn more about PTMs related to Synaptobrevin homolog YKT6 Antibody (NBP1-87439).

Blogs on Synaptobrevin homolog YKT6

There are no specific blogs for Synaptobrevin homolog YKT6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Synaptobrevin homolog YKT6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol YKT6