Syntaxin 3 Antibody

Western Blot: Syntaxin 3 Antibody [NBP1-86984] - Analysis in human cell line SK-MEL-30.

Immunocytochemistry/Immunofluorescence: Syntaxin 3 Antibody [NBP1-86984] - Staining of human cell line U-2 OS shows localization to nucleus, nuclear bodies & the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Syntaxin 3 Antibody [NBP1-86984] - Staining of human pancreas shows moderate to strong positivity in islets of Langerhans.

Immunohistochemistry-Paraffin: Syntaxin 3 Antibody [NBP1-86984] - Staining of human placenta shows moderate to strong membranous positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: Syntaxin 3 Antibody [NBP1-86984] - Staining of human kidney shows moderate to strong positivity in cells in tubules.

Immunohistochemistry-Paraffin: Syntaxin 3 Antibody [NBP1-86984] - Staining of human duodenum shows moderate to strong positivity in apical membrane in glandular cells and lympohoid cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Syntaxin 3 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KQLTQDDDTDAVEIAIDNTAFMDEFFSEIEETRLNIDKISEHVEEAKKLYSIILSAPIPEPKTKDDLEQLTTEIKKRANNVRNKLKSMEKHIEEDEVRSSADLRIRKSQHSVLSRKFVEVMTKYNEAQVDFRERSKGRIQRQLEITGK
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STX3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Syntaxin 3 Protein (NBP1-86984PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Syntaxin 3 Antibody

• FLJ30906
• STX3Asyntaxin 3A
• syntaxin 3
• syntaxin-3

Background

Syntaxin 3 is a member of the SNARE family of proteins and is related to syntaxin 1. While often co-expressed with syntaxins 2 and 4 within the same cell type, its membrane localization is usually different, for instance in epithelial cells or in the exocrine pancreas. Like syntaxins 1,2, and 4 it appears to be involved in the fusion of transport vesicles with the plasma membrane.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STX3