VAChT/SLC18A3 Antibody - BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 473-532 of human VAChT/SLC18A3 (NP_003046.2).
Sequence: GLLTRSRSERDVLLDEPPQGLYDAVRLRERPVSGQDGEPRSPPGPFDACEDDYNYYYTRS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SLC18A3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Immunohistochemistry
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Theoretical MW |
57 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for VAChT/SLC18A3 Antibody - BSA Free
Background
Vesicular Acetylcholine Transporter (VAChT), (approx. 70kD protein), belongs to the family of vesicular monoamine transporters(VMATs), which include VMAT1 and VMAT2 and the C.elegans putative ACh transporter unc-17. Members of this family function to concentrate neurotransmitters into synaptic vesicles through exchange of protons for neurotransmitters. VAChT is a functional transporter for the neurotransmitter acetylcholine(ACh). ACh is synthesized in the cytoplasm by choline acetyl transferase (ChAT) and transported by VAChT into synaptic vesicles where it is stored until released. After release from presynaptic nerve terminals ACh is hydrolyzed by extracellular ACh-esterases(AChE) to choline and acetate. VAChT mRNA is expressed in all known major cholinergic neurons in the central and peripheral nervous system. VAChT is abundantly expressed in the CNS and is mainly localized in small synaptic vesicles in cholinergic nerve terminals. VAChT provides a specific marker for cholinergic neurons for the study of cholinergic transmission in experimental models, in Alzheimer's disease and other nervous system disorders.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Bt, Ca, Eq, Hu, Pm, Mu, Pm, Rb, Rt
Applications: ICC, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
Species: Hu, Mu, Pm, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, WB
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
Publications for VAChT/SLC18A3 Antibody (NBP3-35635) (0)
There are no publications for VAChT/SLC18A3 Antibody (NBP3-35635).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for VAChT/SLC18A3 Antibody (NBP3-35635) (0)
There are no reviews for VAChT/SLC18A3 Antibody (NBP3-35635).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for VAChT/SLC18A3 Antibody (NBP3-35635) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional VAChT/SLC18A3 Products
Research Areas for VAChT/SLC18A3 Antibody (NBP3-35635)
Find related products by research area.
|
Blogs on VAChT/SLC18A3