VAChT/SLC18A3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: VAChT/SLC18A3 Antibody [NBP3-35635] - Immunofluorescence analysis of paraffin-embedded mouse brain using VAChT/SLC18A3 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunohistochemistry: VAChT/SLC18A3 Antibody [NBP3-35635] - Immunohistochemistry analysis of paraffin-embedded Rat brain using VAChT/SLC18A3 Rabbit pAb at dilution of 1:200 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

• Reactivity: Mu, Rt
• Applications: ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

VAChT/SLC18A3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit VAChT/SLC18A3 Antibody - BSA Free (NBP3-35635) is a polyclonal antibody validated for use in IHC, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 473-532 of human VAChT/SLC18A3 (NP_003046.2).
  
  Sequence:
  GLLTRSRSERDVLLDEPPQGLYDAVRLRERPVSGQDGEPRSPPGPFDACEDDYNYYYTRS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC18A3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Theoretical MW: 57 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for VAChT/SLC18A3 Antibody - BSA Free

• MGC12716
• SLC18A3
• solute carrier family 18 (vesicular acetylcholine), member 3
• Solute carrier family 18 member 3
• solute carrier family 18, member 3
• VAChT
• VACHTvesicular acetylcholine transporter

Background

Vesicular Acetylcholine Transporter (VAChT), (approx. 70kD protein), belongs to the family of vesicular monoamine transporters(VMATs), which include VMAT1 and VMAT2 and the C.elegans putative ACh transporter unc-17. Members of this family function to concentrate neurotransmitters into synaptic vesicles through exchange of protons for neurotransmitters. VAChT is a functional transporter for the neurotransmitter acetylcholine(ACh). ACh is synthesized in the cytoplasm by choline acetyl transferase (ChAT) and transported by VAChT into synaptic vesicles where it is stored until released. After release from presynaptic nerve terminals ACh is hydrolyzed by extracellular ACh-esterases(AChE) to choline and acetate. VAChT mRNA is expressed in all known major cholinergic neurons in the central and peripheral nervous system. VAChT is abundantly expressed in the CNS and is mainly localized in small synaptic vesicles in cholinergic nerve terminals. VAChT provides a specific marker for cholinergic neurons for the study of cholinergic transmission in experimental models, in Alzheimer's disease and other nervous system disorders.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC18A3