UXT Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: UXT Antibody [NBP2-54953] - Staining of human cell line HEK 293 shows localization to microtubule organizing center.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UXT Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QEPIMATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQEAKHSE
Specificity
Specificity of human UXT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UXT
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Mouse 81%, Rat 80%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for UXT Antibody

  • Androgen receptor trapped clone 27 protein
  • ART-27protein UXT
  • SKP2-associated alpha PFD 1
  • STAP1
  • Ubiquitously expressed transcript protein
  • ubiquitously-expressed transcript

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-53144
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ye, Ze
Applications: WB, IHC
NBP1-79413
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze, Dr(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ChIP
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ca, Ch, ChHa, Eq, Fe, Ha, Op, Pm, Rb, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Single Cell Western
NBP2-19428
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83349
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-55208
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gt, GP, Rb, Ye, Ze
Applications: WB
AF800
Species: Hu, Mu
Applications: WB, Simple Western, IP
NBP1-86815
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP
NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-54953
Species: Hu
Applications: ICC/IF

Publications for UXT Antibody (NBP2-54953) (0)

There are no publications for UXT Antibody (NBP2-54953).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UXT Antibody (NBP2-54953) (0)

There are no reviews for UXT Antibody (NBP2-54953). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for UXT Antibody (NBP2-54953) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional UXT Products

Bioinformatics Tool for UXT Antibody (NBP2-54953)

Discover related pathways, diseases and genes to UXT Antibody (NBP2-54953). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UXT Antibody (NBP2-54953)

Discover more about diseases related to UXT Antibody (NBP2-54953).
 

Pathways for UXT Antibody (NBP2-54953)

View related products by pathway.

PTMs for UXT Antibody (NBP2-54953)

Learn more about PTMs related to UXT Antibody (NBP2-54953).

Blogs on UXT

There are no specific blogs for UXT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UXT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UXT