MRPL39 Antibody - BSA Free

Immunohistochemistry-Paraffin: MRPL39 Antibody [NBP1-86815] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MRPL39 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MRPL39 Antibody - BSA Free (NBP1-86815) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ERIVKLHRIGDFIDVSEGPLIPRTSICFQYEVSAVHNLQPTQPSLIRRFQGVSLPVHLRAHFTIWDKLLERSRKMVTEDQSKAT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRPL39
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MRPL39 Protein (NBP1-86815PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MRPL39 Antibody - BSA Free

• C21orf92PRED66
• FLJ20451,39S ribosomal protein L39, mitochondrial
• L39mt39S ribosomal protein L5, mitochondrial
• MGC104174
• MGC3400
• mitochondrial ribosomal protein L39
• MRP-L5L5mt
• MRPL5MSTP003
• PRED22
• RPML5MRP-L39

Background

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within themitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. Theyhave an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed.Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA.Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes inbiochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein.Two transcript variants encoding distinct isoforms have been described. A pseudogene corresponding to this gene isfound on chromosome 5q. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRPL39