USP4 Antibody

Images

 
Western Blot: USP4 Antibody [NBP1-86876] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: USP4 Antibody [NBP1-86876] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: USP4 Antibody [NBP1-86876] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
Western Blot: USP4 Antibody [NBP1-86876] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

USP4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NMVVADVYNHRFHKIFQMDEGLNHIMPRDDIFVYEVCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
USP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
USP4 Protein (NBP1-86876PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for USP4 Antibody

  • Deubiquitinating enzyme 4
  • EC 3.1.2.15
  • EC 3.4.19.12
  • MGC149848
  • MGC149849
  • ubiquitin carboxyl-terminal esterase 4
  • ubiquitin carboxyl-terminal hydrolase 4
  • ubiquitin specific peptidase 4 (proto-oncogene)
  • ubiquitin specific protease 4 (proto-oncogene)
  • ubiquitin thioesterase 4
  • Ubiquitin thiolesterase 4
  • ubiquitin-specific processing protease 4
  • Ubiquitin-specific-processing protease 4
  • Ubiquitous nuclear protein homolog
  • UNP
  • Unph
  • UNPUnph
  • USP4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6008
Species: Hu, Mu, Rt
Applications: WB
H00009958-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00009098-M01
Species: Hu
Applications: WB, ELISA
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB100-513
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-33735
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-26506
Species: Hu, Mu, Rt
H00009266-M02
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-81342
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33548
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00009097-M04
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF3025
Species: Hu
Applications: WB, ICC

Publications for USP4 Antibody (NBP1-86876) (0)

There are no publications for USP4 Antibody (NBP1-86876).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP4 Antibody (NBP1-86876) (0)

There are no reviews for USP4 Antibody (NBP1-86876). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for USP4 Antibody (NBP1-86876) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional USP4 Products

Bioinformatics Tool for USP4 Antibody (NBP1-86876)

Discover related pathways, diseases and genes to USP4 Antibody (NBP1-86876). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP4 Antibody (NBP1-86876)

Discover more about diseases related to USP4 Antibody (NBP1-86876).
 

Pathways for USP4 Antibody (NBP1-86876)

View related products by pathway.

PTMs for USP4 Antibody (NBP1-86876)

Learn more about PTMs related to USP4 Antibody (NBP1-86876).

Blogs on USP4

There are no specific blogs for USP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USP4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol USP4
Entrez